Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3R alpha/CD123, Canine (HEK293, His)

IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation.IL-3R alpha/CD123 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3R alpha/CD123 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3r-alpha-cd123-protein-canine-283a-a-hek293-his.html

Purity

95.00

Smiles

SEKDPDSPIKNLRMEPGSRRLTWDLSGNVSEIKCFINSKYITKAIDSRYCQFYVLPLCEVKNFTISVKQDPPFSTGLQYVPRGAEGKPAAAARGLDCWVHDVDFLTCSWEVGRAAPGDVQYRLYWRDLKAYREQECPRYEANNRGVHVRCRFDDVSRLQRHIQFWVNGTSRRSGIPCSDLCVELPEIERLSPPHITATCNKSYSMMEWKVLSHFNHRFLYELQIQKGTDPASTEKLYENHFVIYNPGNYVAKLKVQGFFRKDWSEWSAPQLFVCDPKDEHRRD

Molecular Formula

609293 (Gene_ID) XP_038305195.1 (S33-D315) (Accession)

Molecular Weight

42-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Receptor-Type Tyrosine-Protein Phosphatase Epsilon (PTPRE) ELISA Kit
MBS9923452 Inquire

Cavy Receptor-Type Tyrosine-Protein Phosphatase Epsilon (PTPRE) ELISA Kit

Sign In for Pricing
View Details
Crtac1 Rat shRNA Lentiviral Particle (Locus ID 171438)
TL712812V 500 µL Each

Crtac1 Rat shRNA Lentiviral Particle (Locus ID 171438)

Sign In for Pricing
View Details
West Nile Virus Antibody
OAMA02321-1MG 1 mg

West Nile Virus Antibody

Sign In for Pricing
View Details
Tris Buffer 0.5M, pH 9.0
42020361-2 1 L

Tris Buffer 0.5M, pH 9.0

Sign In for Pricing
View Details
Methyl 2,5-Bis (trifluoroethoxy) benzoate-d4
455020-01 10 mg

Methyl 2,5-Bis (trifluoroethoxy) benzoate-d4

Sign In for Pricing
View Details
Methyl 2,5-Bis (trifluoroethoxy) benzoate-d4
455020-02 25 mg

Methyl 2,5-Bis (trifluoroethoxy) benzoate-d4

Sign In for Pricing
View Details