Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPAR gamma, Human (C-His, solution)

The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His, solution) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PPAR gamma Protein, Human (C-His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppar-gamma-protein-human-c-his.html

Purity

93.00

Smiles

DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

Molecular Formula

5468 (Gene_ID) P37231-1 (D238-D503) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS504983 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Mouse Collagen Type VII (COL7) ELISA Kit
RD-COL7-Mu-01 96 Tests

Mouse Collagen Type VII (COL7) ELISA Kit

Sign In for Pricing
View Details
Mouse Collagen Type VII (COL7) ELISA Kit
RD-COL7-Mu-02 48 Tests

Mouse Collagen Type VII (COL7) ELISA Kit

Sign In for Pricing
View Details
C19orf50 (KXD1) (NM_001171948) Human Over-expression Lysate
LY432637 100 µg

C19orf50 (KXD1) (NM_001171948) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), 0.2mg/mL
BNUB0262-100 1x 100 µL

Human Lambda Light Chain (HP6054), 0.2mg/mL

Sign In for Pricing
View Details
Ice Flaker BIFL-204
BIFL-204 1 Unit

Ice Flaker BIFL-204

Sign In for Pricing
View Details