RuvB, E.coli (His-SUMO)
RuvB protein is an important component of the RuvABC complex and plays a key role in recombinant DNA repair, especially for UV-induced damage. It helps rescue stalled DNA replication forks through replication fork reversal (RFR) . RuvB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvB protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Product Specifications
Product Name Alternative
RuvB Protein, E.coli (His-SUMO), E.coli, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ruvb-protein-e-coli-his-sumo.html
Purity
90.0
Smiles
MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP
Molecular Formula
946371 (Gene_ID) P0A812 (M1-P336) (Accession)
Molecular Weight
Approximately 53.2 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
4252-040-ESK-PS3 1 Kit
CometAssay 20 Well ES Starter Kit plus Power Supply for UK
Sign In for Pricing
View Details 
CST 96420SF 100 µg
KLF2 (E7K8Y) Rabbit Monoclonal Antibody (BSA and Azide Free)
Sign In for Pricing
View Details MBS7093234 Inquire
Recombinant Shewanella oneidensis Membrane protein insertase YidC (yidC), partial
Sign In for Pricing
View Details