RuvB, E.coli (His-SUMO)
RuvB protein is an important component of the RuvABC complex and plays a key role in recombinant DNA repair, especially for UV-induced damage. It helps rescue stalled DNA replication forks through replication fork reversal (RFR) . RuvB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvB protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Product Specifications
Product Name Alternative
RuvB Protein, E.coli (His-SUMO), E.coli, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ruvb-protein-e-coli-his-sumo.html
Purity
90.0
Smiles
MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP
Molecular Formula
946371 (Gene_ID) P0A812 (M1-P336) (Accession)
Molecular Weight
Approximately 53.2 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6195474-01 0.1 mL
FBXO8 (F-Box Protein 8, DC10, FBS, FBX8) (MaxLight 405)
Sign In for Pricing
View Details MBS6195474-02 5x 0.1 mL
FBXO8 (F-Box Protein 8, DC10, FBS, FBX8) (MaxLight 405)
Sign In for Pricing
View Details 
TRV-0034768-01 20 µL
Monoclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)
Sign In for Pricing
View Details TRV-0034768-02 100 µL
Monoclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)
Sign In for Pricing
View Details TRV-0034768-03 200 µL
Monoclonal Antibody to Parathyroid Hormone Related Protein (PTHrP)
Sign In for Pricing
View Details