Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Non-Receptor tyrosine-protein Kinase TNK1 (TNK1) Mouse ELISA Kit
F4202 96 Tests

Non-Receptor tyrosine-protein Kinase TNK1 (TNK1) Mouse ELISA Kit

Sign In for Pricing
View Details
Human Lipid bound sialic acid (LSA) ELISA Kit
NSL0489Hu 96 Tests

Human Lipid bound sialic acid (LSA) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit
MBS7259232-01 48 Well

Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit
MBS7259232-02 96 Well

Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit
MBS7259232-03 5x 96 Well

Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit
MBS7259232-04 10x 96 Well

Goat Olfactory Receptor 10A5 (OR10A5) ELISA Kit

Sign In for Pricing
View Details