Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gab2 (Phospho-Tyr452) discontinued
316644 100 µL

Gab2 (Phospho-Tyr452) discontinued

Sign In for Pricing
View Details
SMAD2 Polyclonal Antibody
E-AB-68278-01 60 µL

SMAD2 Polyclonal Antibody

Sign In for Pricing
View Details
SMAD2 Polyclonal Antibody
E-AB-68278-02 120 µL

SMAD2 Polyclonal Antibody

Sign In for Pricing
View Details
SMAD2 Polyclonal Antibody
E-AB-68278-03 200 µL

SMAD2 Polyclonal Antibody

Sign In for Pricing
View Details
SMCHD1 (NM_015295) Human Untagged Clone
SC316455 10 µg

SMCHD1 (NM_015295) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Tardbp shRNA (UAS) - Lentiviral mouse Tardbp shRNA (UAS, RFP) (100)
GTR15157584 1 Vial

Lentiviral mouse Tardbp shRNA (UAS) - Lentiviral mouse Tardbp shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details