Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Dichloro-2,4-difluoroaniline
TRC-D434765-500MG 500 mg

3,5-Dichloro-2,4-difluoroaniline

Sign In for Pricing
View Details
Stat4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6493106 1.0 µg DNA

Stat4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
TRAJ54 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV787551 1.0 µg DNA

TRAJ54 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
SPN (Structural Protein-Nucleocapsid) discontinued
544110 100 µg

SPN (Structural Protein-Nucleocapsid) discontinued

Sign In for Pricing
View Details
Palmitylethanolamide
BML-FA018-0050 50 mg

Palmitylethanolamide

Sign In for Pricing
View Details
Mouse Monoclonal ZFP64 Antibody (PCRP-ZFP64-1H2) [Alexa Fluor 532]
NBP3-08648AF532 100 µL

Mouse Monoclonal ZFP64 Antibody (PCRP-ZFP64-1H2) [Alexa Fluor 532]

Sign In for Pricing
View Details