Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBL1X/SMAP55 Polyclonal Antibody, Cy5 Conjugated
bs-4219R-Cy5 100 µL

TBL1X/SMAP55 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
pCMV-SPORT6-TBP Plasmid
PVT23575 2 µg

pCMV-SPORT6-TBP Plasmid

Sign In for Pricing
View Details
Map2k3, ID (Map2k3, Mkk3, Prkmk3, Dual specificity mitogen-activated protein kinase kinase 3, MAPK/ERK kinase 3) (Azide free) (HRP) discontinued
038129-HRP 200 µL

Map2k3, ID (Map2k3, Mkk3, Prkmk3, Dual specificity mitogen-activated protein kinase kinase 3, MAPK/ERK kinase 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Interferon regulatory factor 9 Recombinant Rabbit mAb
E43S47917 100 µL

Interferon regulatory factor 9 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PKC iota, Recombinant, Human, His-Tag, aa1-596
046026-01 20 µg

PKC iota, Recombinant, Human, His-Tag, aa1-596

Sign In for Pricing
View Details
PKC iota, Recombinant, Human, His-Tag, aa1-596
046026-02 100 µg

PKC iota, Recombinant, Human, His-Tag, aa1-596

Sign In for Pricing
View Details