Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Mouse Nuclear Factor Of Activated T-Cells, Cytoplasmic 1 (NFATC1) ELISA
KLM5995 1x 96 Well

GENLISA™ Mouse Nuclear Factor Of Activated T-Cells, Cytoplasmic 1 (NFATC1) ELISA

Sign In for Pricing
View Details
Human WDR1 knockdown cell line
ABC-KD16897 1 Vial

Human WDR1 knockdown cell line

Sign In for Pricing
View Details
Rat Monoclonal Integrin beta 1/CD29 Antibody (265917) [HRP]
FAB2405H 0.1 mL

Rat Monoclonal Integrin beta 1/CD29 Antibody (265917) [HRP]

Sign In for Pricing
View Details
Human CERCAM Knockout A549 cell line
GTR15419507 1 Vial

Human CERCAM Knockout A549 cell line

Sign In for Pricing
View Details
Mouse Monoclonal GATA-3 Antibody (rGATA3/3870) [Janelia Fluor 635]
NBP3-20864JF635 0.1 mL

Mouse Monoclonal GATA-3 Antibody (rGATA3/3870) [Janelia Fluor 635]

Sign In for Pricing
View Details
PPP1R7 Protein Vector (Human) (pPB-N-His)
PV032502 500 ng

PPP1R7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details