Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2Y4 discontinued
392664 200 µL

P2Y4 discontinued

Sign In for Pricing
View Details
TALDO1 discontinued
395162 200 µL

TALDO1 discontinued

Sign In for Pricing
View Details
Human ICAM-1/CD54 ELISA Kit
EHI0332 96 Tests

Human ICAM-1/CD54 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human SGK1 PolyClonal Antibody
MBS1489631-01 0.1 mL

Rabbit Anti Human SGK1 PolyClonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human SGK1 PolyClonal Antibody
MBS1489631-02 5x 0.1 mL

Rabbit Anti Human SGK1 PolyClonal Antibody

Sign In for Pricing
View Details
NDFIP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1406607 1.0 µg DNA

NDFIP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details