Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NQO2 (NM_000904) Human Recombinant Protein
TP302889 20 µg

NQO2 (NM_000904) Human Recombinant Protein

Sign In for Pricing
View Details
Human Apolipoprotein C4 (APOC4) ELISA Kit
RD-APOC4-Hu-48Tests 48 Tests

Human Apolipoprotein C4 (APOC4) ELISA Kit

Sign In for Pricing
View Details
Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform (PPP2R2D) ELISA Kit
abx500128 96 Tests

Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform (PPP2R2D) ELISA Kit

Sign In for Pricing
View Details
WISP1 (Wnt 1 induced Secreted Protein 1, Wnt-1-induced Secreted Protein 1, Wnt1-induced Secreted Protein 1, WISP 1, WISP-1, CCN4, WISP1c, WISP1i, WISP1tc, Wnt-1-induced Secreted Protein, Wnt1-induced Secreted Protein, Wnt-1-inducible Signaling Pathway Protein 1, Wnt1-inducible Signaling Pathway Protein 1, Wnt 1 Signaling Pathway Protein 1, Wnt1 Signaling Pathway Protein 1, Wnt-1 Signaling Pathway Protein 1)
W1450-50A 100 µg

WISP1 (Wnt 1 induced Secreted Protein 1, Wnt-1-induced Secreted Protein 1, Wnt1-induced Secreted Protein 1, WISP 1, WISP-1, CCN4, WISP1c, WISP1i, WISP1tc, Wnt-1-induced Secreted Protein, Wnt1-induced Secreted Protein, Wnt-1-inducible Signaling Pathway Protein 1, Wnt1-inducible Signaling Pathway Protein 1, Wnt 1 Signaling Pathway Protein 1, Wnt1 Signaling Pathway Protein 1, Wnt-1 Signaling Pathway Protein 1)

Sign In for Pricing
View Details
Arih1 ORF Vector (Mouse) (pORF)
ORF039026 1.0 µg DNA

Arih1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
TAS2R60 (NM_177437) Human Tagged ORF Clone Lentiviral Particle
RC222067L4V 200 µL

TAS2R60 (NM_177437) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details