Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD45C CRISPRa sgRNA lentivector (set of three targets)(Human)
44881121 3x 1.0µg DNA

SNORD45C CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Mannosyl phosphorylinositol ceramide synthase CSH1 (CSH1) , partial
MBS7060902 Inquire

Recombinant Saccharomyces cerevisiae Mannosyl phosphorylinositol ceramide synthase CSH1 (CSH1) , partial

Sign In for Pricing
View Details
a1C Calcium Channel
MBS395969-01 0.1 mg

a1C Calcium Channel

Sign In for Pricing
View Details
a1C Calcium Channel
MBS395969-02 5x 0.1 mg

a1C Calcium Channel

Sign In for Pricing
View Details
FBXO2 (NM_012168) Human Mass Spec Standard
PH310500 10 µg

FBXO2 (NM_012168) Human Mass Spec Standard

Sign In for Pricing
View Details
Chromosome transmission fidelity protein 8 homolog isoform 2 (CHTF8) Rat ELISA Kit
C3654 96 Tests

Chromosome transmission fidelity protein 8 homolog isoform 2 (CHTF8) Rat ELISA Kit

Sign In for Pricing
View Details