Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cadherin, Neuronal (CDH2) ELISA Kit
RDR-CDH2-Mu-96Tests 96 Tests

Mouse Cadherin, Neuronal (CDH2) ELISA Kit

Sign In for Pricing
View Details
Nnat (NM_053601) Rat Untagged Clone
RN200241 10 µg

Nnat (NM_053601) Rat Untagged Clone

Sign In for Pricing
View Details
Human VEGF Matched Antibody Pair Set [IV02-114/RD0F-147]
Z01LS-0523-LS118 5 Plates

Human VEGF Matched Antibody Pair Set [IV02-114/RD0F-147]

Sign In for Pricing
View Details
FKBP11 (FK506-binding Protein 11, Peptidyl-prolyl Cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11, MGC54182) (PE)
126827-PE 100 µL

FKBP11 (FK506-binding Protein 11, Peptidyl-prolyl Cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11, MGC54182) (PE)

Sign In for Pricing
View Details
CD225 antibody (HRP)
60R-1763 100 ug

CD225 antibody (HRP)

Sign In for Pricing
View Details
Human SPRR2E knockout cell line
ABC-KH14619 1 Vial

Human SPRR2E knockout cell line

Sign In for Pricing
View Details