Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL36 siRNA (Rat)
CRR1579-01 15 nmol

RPL36 siRNA (Rat)

Sign In for Pricing
View Details
RPL36 siRNA (Rat)
CRR1579-02 30 nmol

RPL36 siRNA (Rat)

Sign In for Pricing
View Details
Grap2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3913302 1.0 µg DNA

Grap2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal RhoC Antibody (7X5I9)
NBP3-16333-100ul 100 µL

Rabbit Monoclonal RhoC Antibody (7X5I9)

Sign In for Pricing
View Details
Trerf1 ORF Vector (Mouse) (pORF)
47707014 1.0 µg DNA

Trerf1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RGS20 (NM_003702) Human Tagged ORF Clone
RC209495 10 µg

RGS20 (NM_003702) Human Tagged ORF Clone

Sign In for Pricing
View Details