Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-17, Human (HEK293, His)

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (HEK293, His) is the recombinant human-derived FGF-17 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-17-protein-human-hek293-his.html

Purity

95.0

Smiles

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Molecular Formula

8822 (Gene_ID) O60258 (T23-T216) (Accession)

Molecular Weight

Approximately 31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

[One Step] RALB Antibody Kit
MBS9145349-01 0.02 mL

[One Step] RALB Antibody Kit

Sign In for Pricing
View Details
[One Step] RALB Antibody Kit
MBS9145349-02 0.1 mL

[One Step] RALB Antibody Kit

Sign In for Pricing
View Details
[One Step] RALB Antibody Kit
MBS9145349-03 5x 0.1 mL

[One Step] RALB Antibody Kit

Sign In for Pricing
View Details
Lentiviral mouse Atg5 shRNA (UAS) - Lentiviral mouse Atg5 shRNA (UAS, iRFP) (100)
GTR15165015 1 Vial

Lentiviral mouse Atg5 shRNA (UAS) - Lentiviral mouse Atg5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SGK1 Rabbit mAb
A3936 500 µL

SGK1 Rabbit mAb

Sign In for Pricing
View Details
Human Ovary PrimaCell™2: Normal Ovarian Firbroblasts Growth Medium
9-46095 5x 100 mL

Human Ovary PrimaCell™2: Normal Ovarian Firbroblasts Growth Medium

Sign In for Pricing
View Details