CG beta 3, Human (HEK293, His)
CG beta 3 Protein, Human (HEK 293, His) is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG) .
Product Specifications
Product Name Alternative
CG beta 3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cg-beta-3-protein-human-hek-293-his.html
Purity
95.0
Smiles
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Molecular Formula
1082 (Gene_ID) P0DN86 (S21-Q165) (Accession)
Molecular Weight
28-35 kDa
References & Citations
[1]J L Jameson, et al. Isolation and characterization of the human chorionic gonadotropin beta subunit (CG beta) gene cluster: regulation of transcriptionally active CG beta gene by cyclic AMP. Mol Cell Biol. 1988 Dec;8 (12) :5100-7.|[2]B L Strauss, et al. Expression of the beta subunit of chorionic gonadotropin in transgenic mice. J Biol Chem. 1994 Feb 18;269 (7) :4968-73.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HK206232 1 Kit
Renin (REN) Human qPCR Template Standard (NM_000537)
Sign In for Pricing
View Details 