Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-36RN, Mouse

IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-36RN Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-36rn-protein-mouse.html

Purity

95.60

Smiles

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) NP_062324.2 (V3-D156) (Accession)

Molecular Weight

Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HIGD1B sgRNA gene knockout kit - Lentiviral human HIGD1B sgRNA gene knockout kit (plasmid)
GTR15396716 1 Vial

Lentiviral human HIGD1B sgRNA gene knockout kit - Lentiviral human HIGD1B sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
SLC6A3 Antibody Blocking peptide
orb1454316 500 µg

SLC6A3 Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Human CD46 Protein, C-Fc
HB735021-01 50 µg

Recombinant Human CD46 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD46 Protein, C-Fc
HB735021-02 100 µg

Recombinant Human CD46 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD46 Protein, C-Fc
HB735021-03 1 mg

Recombinant Human CD46 Protein, C-Fc

Sign In for Pricing
View Details
TBC1D8 Antibody (C-term) Blocking Peptide
MBS9222089-01 0.5 mg

TBC1D8 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details