Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-36RN, Mouse

IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-36RN Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-36rn-protein-mouse.html

Purity

95.60

Smiles

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) NP_062324.2 (V3-D156) (Accession)

Molecular Weight

Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit
MBS8801138-01 48 Strip Well

Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit
MBS8801138-02 96 Strip Well

Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit
MBS8801138-03 5x 96 Strip Well

Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit
MBS8801138-04 10x 96 Strip Well

Human a2ML1 (Alpha-2-Macroglobulin Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1) , partial
MBS1304855-01 0.02 mg (E-Coli)

Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1) , partial

Sign In for Pricing
View Details
Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1) , partial
MBS1304855-02 0.1 mg (E-Coli)

Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1) , partial

Sign In for Pricing
View Details