Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-36RN, Mouse

IL-36RN protein exhibits cytokine activity, interleukin 1 receptor antagonist activity, and interleukin 1 receptor binding activity. It negatively regulates IL-6 production and is predicted to be localized in the cytoplasm and extracellular regions. IL-36RN Protein, Mouse is the recombinant mouse-derived IL-36RN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-36RN Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-36rn-protein-mouse.html

Purity

95.60

Smiles

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Molecular Formula

54450 (Gene_ID) NP_062324.2 (V3-D156) (Accession)

Molecular Weight

Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AUP1 Polyclonal Antibody
E-AB-10796-01 20 µL

AUP1 Polyclonal Antibody

Sign In for Pricing
View Details
AUP1 Polyclonal Antibody
E-AB-10796-02 60 µL

AUP1 Polyclonal Antibody

Sign In for Pricing
View Details
AUP1 Polyclonal Antibody
E-AB-10796-03 120 µL

AUP1 Polyclonal Antibody

Sign In for Pricing
View Details
AUP1 Polyclonal Antibody
E-AB-10796-04 200 µL

AUP1 Polyclonal Antibody

Sign In for Pricing
View Details
Canine Paraspeckle Component 1 (PSPC1) ELISA Kit
MBS9914781-01 48 Well

Canine Paraspeckle Component 1 (PSPC1) ELISA Kit

Sign In for Pricing
View Details
Canine Paraspeckle Component 1 (PSPC1) ELISA Kit
MBS9914781-02 96 Well

Canine Paraspeckle Component 1 (PSPC1) ELISA Kit

Sign In for Pricing
View Details