Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6)

Product Specifications

Product Name Alternative

B-cell stimulatory factor 2 ; BSF-2; CTL differentiation factor ; CDFHybridoma growth factorInterferon beta-2 ; IFN-beta-2

Abbreviation

Recombinant Human IL6 protein

Gene Name

IL6

UniProt

P05231

Expression Region

30-212aa

Organism

Homo sapiens (Human)

Target Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hatopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SREBP1 (SREBF1) (Center) Rabbit Polyclonal Antibody
AP18209PU-N 400 µL

SREBP1 (SREBF1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant STX16 Antibody
RC-4704-01 50 μL

Recombinant STX16 Antibody

Sign In for Pricing
View Details
Recombinant STX16 Antibody
RC-4704-02 100 µL

Recombinant STX16 Antibody

Sign In for Pricing
View Details
Recombinant STX16 Antibody
RC-4704-03 1 mL

Recombinant STX16 Antibody

Sign In for Pricing
View Details
HOXC9 Polyclonal Antibody
E-AB-19499-01 20 µL

HOXC9 Polyclonal Antibody

Sign In for Pricing
View Details
HOXC9 Polyclonal Antibody
E-AB-19499-02 60 µL

HOXC9 Polyclonal Antibody

Sign In for Pricing
View Details