Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPLX3, Human (HEK293, His)

CPLX3 protein is a complex protein that regulates synaptic vesicle fusion through the SNARE protein complex. CPLX3 Protein, Human (HEK293, His) is the recombinant human-derived CPLX3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CPLX3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cplx3-protein-human-hek293-his.html

Purity

97.00

Smiles

MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEK

Molecular Formula

594855 (Gene_ID) Q8WVH0 (M1-K154) (Accession)

Molecular Weight

Approximately 27-33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transaldolase 1 Polyclonal Antibody, FITC Conjugated
bs-4041R-FITC 100 µL

Transaldolase 1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
RAB3GAP2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11939R-BF680 100 µL

RAB3GAP2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
PLCL2 (NM_015184) Human Tagged Lenti ORF Clone
RC207303L3 10 µg

PLCL2 (NM_015184) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OR4D2 Antibody
44610-01 50 µL

OR4D2 Antibody

Sign In for Pricing
View Details
OR4D2 Antibody
44610-02 100 µL

OR4D2 Antibody

Sign In for Pricing
View Details
(E) -Doxepin Hydrochloride
447975-01 10 mg

(E) -Doxepin Hydrochloride

Sign In for Pricing
View Details