Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR70 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50363066 1.0 µg DNA

WDR70 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Gamma-Glutamylcysteine Synthetase (GGCS) ELISA Kit
MBS9900606 Inquire

Rabbit Gamma-Glutamylcysteine Synthetase (GGCS) ELISA Kit

Sign In for Pricing
View Details
KLF10 (EGRA, TIEG, TIEG1, Kruppel-like Factor 10)
377161 100 µg

KLF10 (EGRA, TIEG, TIEG1, Kruppel-like Factor 10)

Sign In for Pricing
View Details
MRPL43 (NM_176793) Human Tagged ORF Clone Lentiviral Particle
RC208799L3V 200 µL

MRPL43 (NM_176793) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
XRCC6, CT (XRCC6, G22P1, X-ray repair cross-complementing protein 6, 5'-deoxyribose-5-phosphate lyase Ku70, 70kD subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, DNA repair protein XRCC6, Lupus Ku autoantigen protein p70, Thyroid-lupus autoantigen, X-ray repair complementing defective repair in Chinese hamster cells 6) (MaxLight 490) discontinued
043935-ML490 100 µL

XRCC6, CT (XRCC6, G22P1, X-ray repair cross-complementing protein 6, 5'-deoxyribose-5-phosphate lyase Ku70, 70kD subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, DNA repair protein XRCC6, Lupus Ku autoantigen protein p70, Thyroid-lupus autoantigen, X-ray repair complementing defective repair in Chinese hamster cells 6) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Anti-CD5 Antibody-FITC (8Q487)
MF-0070061-01 25 Tests

Anti-CD5 Antibody-FITC (8Q487)

Sign In for Pricing
View Details