Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Benzoyl- (2R,3S) -3-phenylisoseryl-CoA
HY-CE01583 1 Each

N-Benzoyl- (2R,3S) -3-phenylisoseryl-CoA

Sign In for Pricing
View Details
Tlr12 Protein Vector (Mouse) (pPM-C-HA)
46773024 500 ng

Tlr12 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
beta-Amyloid Peptide, 28aa (MaxLight 550)
MBS6259617-01 0.1 mL

beta-Amyloid Peptide, 28aa (MaxLight 550)

Sign In for Pricing
View Details
beta-Amyloid Peptide, 28aa (MaxLight 550)
MBS6259617-02 5x 0.1 mL

beta-Amyloid Peptide, 28aa (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Monoclonal Anti- BAG6 antibody
BRM1015-2 100 µL

Recombinant Monoclonal Anti- BAG6 antibody

Sign In for Pricing
View Details
Snapc3 3'UTR GFP Stable Cell Line
TU169374 1.0 mL

Snapc3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details