Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a9 siRNA Oligos set (Rat)
43966176 3x 5 nmol

Slc22a9 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal RBBP9 Antibody
NBP2-55018 100 µL

Rabbit Polyclonal RBBP9 Antibody

Sign In for Pricing
View Details
Gamma-Aminobutyric Acid Receptor Subunit Epsilon (GABRE) Antibody (ATTO 390)
abx440251 100 µg

Gamma-Aminobutyric Acid Receptor Subunit Epsilon (GABRE) Antibody (ATTO 390)

Sign In for Pricing
View Details
AGPAT1 3'UTR GFP Stable Cell Line
TU050471 1.0 mL

AGPAT1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor-Inducible Gene 6 Protein (TNFAIP6) ELISA Kit
abx392412-01 96 Tests

Rat Tumor Necrosis Factor-Inducible Gene 6 Protein (TNFAIP6) ELISA Kit

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor-Inducible Gene 6 Protein (TNFAIP6) ELISA Kit
abx392412-02 5x 96 Tests

Rat Tumor Necrosis Factor-Inducible Gene 6 Protein (TNFAIP6) ELISA Kit

Sign In for Pricing
View Details