Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pebp1 (NM_018858) Mouse Tagged Lenti ORF Clone
MR201759L3 10 µg

Pebp1 (NM_018858) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GOLGA6L7P Recombinant Protein (Human)
RP060870 100 µg

GOLGA6L7P Recombinant Protein (Human)

Sign In for Pricing
View Details
CCAAT/Enhancer Binding Protein α (C/EBPα) Guinea Pig ELISA Kit
B9896 96 Tests

CCAAT/Enhancer Binding Protein α (C/EBPα) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
CBFB (Core Binding Factor beta)
477168 100 µL

CBFB (Core Binding Factor beta)

Sign In for Pricing
View Details
Fhit (G-4) Alexa Fluor® 546
sc-390481 AF546 200 µg/mL

Fhit (G-4) Alexa Fluor® 546

Sign In for Pricing
View Details
Rabbit Anti-GROγ/CXCL3 Polyclonal Antibody
PAV7775 100 μL

Rabbit Anti-GROγ/CXCL3 Polyclonal Antibody

Sign In for Pricing
View Details