Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk17 Knockout RAW 264.7 Polyclonal Cells
ARG12518 1 Million

Cdk17 Knockout RAW 264.7 Polyclonal Cells

Sign In for Pricing
View Details
Ethyllucidone
MF-0154007 5 mg

Ethyllucidone

Sign In for Pricing
View Details
Human IRF5 (NM_001098628) AAV Particle
RC216505A1V 250 µL

Human IRF5 (NM_001098628) AAV Particle

Sign In for Pricing
View Details
Fmoc-β- (3-thienyl) -D-Ala-OH
sc-228141 250 mg

Fmoc-β- (3-thienyl) -D-Ala-OH

Sign In for Pricing
View Details
Human Monoclonal IL-17E/IL-25 Antibody (Centocor patent anti-IL-25) [Janelia Fluor 635]
NBP3-28161JF635 0.1 mL

Human Monoclonal IL-17E/IL-25 Antibody (Centocor patent anti-IL-25) [Janelia Fluor 635]

Sign In for Pricing
View Details
SLC9A2 Conjugated Antibody
MBS9454207-01 0.1 mL (AF350)

SLC9A2 Conjugated Antibody

Sign In for Pricing
View Details