IGF-I/IGF-1, Human (P. pastoris, N-His)
The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html
Purity
95.00
Smiles
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula
3479 (Gene_ID) P05019-1 (G49-A118) (Accession)
Molecular Weight
Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Mycoplasma pneumoniae / Chl. pneumoniae Real-TM Real Time PCR test for detection of Chlamydia and Mycoplasma pneumoniae
Recombinant Rat Activator of apoptosis harakiri (Hrk)
CD19 (B Lymphocyte Antigen CD19, B4, Differentiation Antigen CD19, Leu 12, Leu-12, MGC12802) (FITC) discontinued
Activin receptor type-1 Recombinant Antibody, PE Conjugated