Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR2G6 qPCR Primer Pair
QH76397S 200 Tests

Human OR2G6 qPCR Primer Pair

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)
MBS2094775-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)
MBS2094775-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)
MBS2094775-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)
MBS2094775-04 1 mL

Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)
MBS2094775-05 5 mL

Biotin-Linked Polyclonal Antibody to Nicastrin (NCSTN)

Sign In for Pricing
View Details