Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRG2C Human shRNA Plasmid Kit (Locus ID 100288801)
TL321198 1 Kit

FRG2C Human shRNA Plasmid Kit (Locus ID 100288801)

Sign In for Pricing
View Details
KDELR2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV711596 1.0 µg DNA

KDELR2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-CCR4/CNOT6 (AT008) Biosimilar (Monoclonal, IgG)
A135778 100 µL

Anti-CCR4/CNOT6 (AT008) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
Rabbit Monoclonal MSH6 Antibody (035) [DyLight 350]
NBP2-89265UV 0.1 mL

Rabbit Monoclonal MSH6 Antibody (035) [DyLight 350]

Sign In for Pricing
View Details
GAGE2B Antibody (N-term) [APR31078G]
APR31078G-01 50 µL

GAGE2B Antibody (N-term) [APR31078G]

Sign In for Pricing
View Details
GAGE2B Antibody (N-term) [APR31078G]
APR31078G-02 100 µL

GAGE2B Antibody (N-term) [APR31078G]

Sign In for Pricing
View Details