Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Mouse IgA-HRP Conjugated
31-1360-1.0 1 mL

Goat Anti-Mouse IgA-HRP Conjugated

Sign In for Pricing
View Details
Human PTMAP12 Pre-designed siRNA Set B
SI013118B 1 Each

Human PTMAP12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human ARNTL2 sgRNA gene knockout kit - Lentiviral human ARNTL2 sgRNA gene knockout kit (100)
GTR15360034 1 Vial

Lentiviral human ARNTL2 sgRNA gene knockout kit - Lentiviral human ARNTL2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
pOTB7-MARK2 Plasmid
PVT26929 2 µg

pOTB7-MARK2 Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal CD8 Antibody (UCH-T4) [DyLight 594]
NBP2-50468DL594 0.1 mL

Mouse Monoclonal CD8 Antibody (UCH-T4) [DyLight 594]

Sign In for Pricing
View Details
Recombinant Bacillus pumilus Holliday junction resolvase recU (recU)
MBS1015354-01 0.02 mg (E-Coli)

Recombinant Bacillus pumilus Holliday junction resolvase recU (recU)

Sign In for Pricing
View Details