Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CECR3 Protein Vector (Human) (pPM-C-HA)
PV068871 500 ng

CECR3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SMEK2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
44446126 3x 1.0µg DNA

SMEK2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human ATP10D Pre-designed siRNA Set B
SI001235B 1 Each

Human ATP10D Pre-designed siRNA Set B

Sign In for Pricing
View Details
RNF20 Adenovirus (Human)
40286051 1.0 mL

RNF20 Adenovirus (Human)

Sign In for Pricing
View Details
Mrip-ps Mouse siRNA Oligo Duplex (Locus ID 666407)
SR410824 1 Kit

Mrip-ps Mouse siRNA Oligo Duplex (Locus ID 666407)

Sign In for Pricing
View Details
Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (FOLH1/2121) [Alexa Fluor 700]
NBP3-08373AF700 100 µL

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (FOLH1/2121) [Alexa Fluor 700]

Sign In for Pricing
View Details