Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (P. pastoris, N-His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. IGF-I/IGF-1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived IGF-I/IGF-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (P. pastoris, N-His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-p-pastoris-n-his.html

Purity

95.00

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp597-set siRNA/shRNA/RNAi Lentivector (Rat)
51039096 4x 500 ng

Zfp597-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Vamp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
49418116 3x 1.0 µg

Vamp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
VPS52 (NM_001289175) Human Untagged Clone
SC336933 10 µg

VPS52 (NM_001289175) Human Untagged Clone

Sign In for Pricing
View Details
Rem1 AAV siRNA Pooled Vector
38808164 1.0 µg

Rem1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GABRA6 Protein Vector (Human) (pPB-C-His)
PV052469 500 ng

GABRA6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Fen1 shRNA (UAS) - Lentiviral mouse Fen1 shRNA (UAS, iRFP) (100)
GTR15243483 1 Vial

Lentiviral mouse Fen1 shRNA (UAS) - Lentiviral mouse Fen1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details