Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BZW2, Human (GST)

BZW2 is a translation initiation regulator that inhibits non-AUG and RAN-initiated translation. As a competitive inhibitor of EIF5, it improves initiation accuracy by preventing EIF5-dependent translation of non-AUG codons. BZW2 Protein, Human (GST) is the recombinant human-derived BZW2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

BZW2 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bzw2-protein-human-gst.html

Smiles

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Molecular Formula

28969 (Gene_ID) Q9Y6E2-1 (M1-N419) (Accession)

Molecular Weight

75.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHCHD1 Human qPCR Primer Pair (NM_203298)
HP219527 200 Reactions

CHCHD1 Human qPCR Primer Pair (NM_203298)

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-1202
BCBS-1202 1 Unit

Biological Safety Cabinet Class II BCBS-1202

Sign In for Pricing
View Details
Catalase (CAT) (NM_001752) Human Over-expression Lysate
LY419766 100 µg

Catalase (CAT) (NM_001752) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
E-EL-H2436-01 24 Tests

Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit

Sign In for Pricing
View Details
Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
E-EL-H2436-02 48 Tests

Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit

Sign In for Pricing
View Details
Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
E-EL-H2436-03 96 Tests

Human TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit

Sign In for Pricing
View Details