Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RKIP/PEBP1, Human

The RKIP/PEBP1 protein has diverse binding capabilities and can interact with ATP, opioids, and phosphatidylethanolamine. It acts as a serine protease inhibitor, effectively inhibiting thrombin, neuroproteases, and chymotrypsin. RKIP/PEBP1 Protein, Human is the recombinant human-derived RKIP/PEBP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RKIP/PEBP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rkip-pebp1-protein-human.html

Purity

98.00

Smiles

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Molecular Formula

5037 (Gene_ID) P30086 (M1-K187) (Accession)

Molecular Weight

Approximately 21.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARMCX4 Knockout HEK293T cell line
GTR15412875 1 Vial

Human ARMCX4 Knockout HEK293T cell line

Sign In for Pricing
View Details
Goose Butyrophilin Subfamily 1, Member A1 ELISA Kit
MBS093571 Inquire

Goose Butyrophilin Subfamily 1, Member A1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SHQ1 Antibody [Biotin]
NBP2-81793B 0.1 mL

Rabbit Polyclonal SHQ1 Antibody [Biotin]

Sign In for Pricing
View Details
Efinaconazole Impurity G
RM-E061407-01 10 mg

Efinaconazole Impurity G

Sign In for Pricing
View Details
Efinaconazole Impurity G
RM-E061407-02 25 mg

Efinaconazole Impurity G

Sign In for Pricing
View Details
Efinaconazole Impurity G
RM-E061407-03 50 mg

Efinaconazole Impurity G

Sign In for Pricing
View Details