Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP TGF beta 1/TGFB1, Human (CHO)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. GMP TGF beta 1/TGFB1 Protein, Human (HEK293) is a GMP-grade recombinant protein (A279-S390) produced by CHO cells[1][2].

Product Specifications

Product Name Alternative

GMP TGF beta 1/TGFB1 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-tgf-beta-1-tgfb1-protein-human-hek293.html

Purity

95.0

Smiles

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Formula

7040 (Gene_ID) P01137 (A279-S390) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]K. Miyazono, et al. A role of the latent TGF-beta 1-binding protein in the assembly and secretion of TGF-beta 1. The EMBO Journal (1991) 10:1091-1101.|[2]M Selvakumaran, et al. The novel primary response gene MyD118 and the proto-oncogenes myb, myc, and bcl-2 modulate transforming growth factor beta 1-induced apoptosis of myeloid leukemia cells. Mol Cell Biol. 1994 Apr;14 (4) :2352-60.|[3]Chambaz E.M., et al. Transforming Growth Factor-βs: A Multifunctional Cytokine Family. Implication in the Regulation of Adrenocortical Cell Endocrine Functions. 1991. |[4]Dulce Maroni, et al. TGFB1 disrupts the angiogenic potential of microvascular endothelial cells of the corpus luteum. Cell Sci. 2011 Jul 15;124 (Pt 14) :2501-10.|[5]Nan Wu, et al. LINC00941 promotes CRC metastasis through preventing SMAD4 protein degradation and activating the TGF-β/SMAD2/3 signaling pathway. Cell Death Differ. 2021 Jan;28 (1) :219-232. |[6]Hai Zhang, et al. Effects of transforming growth factor-beta 1 (TGF-beta1) on in vitro mineralization of human osteoblasts on implant materials. Biomaterials. 2003 May;24 (12) :2013-20. |[7]Paloma B Liton, et al. Cross-talk between TGF-beta1 and IL-6 in human trabecular meshwork cells. Mol Vis. 2009;15:326-34. Epub 2009 Feb 11.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium nitrate
GK2648-100g 100 g

Sodium nitrate

Sign In for Pricing
View Details
pDRIVE-SV40-hAlb
pdrive-sv40halb 20 µg

pDRIVE-SV40-hAlb

Sign In for Pricing
View Details
MYL3 Rabbit Polyclonal Antibody
E53P10042 100 µL

MYL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Irisin/FNDC5 MAb (Clone 1056111)
MAB94201-100 100 µg

Human Irisin/FNDC5 MAb (Clone 1056111)

Sign In for Pricing
View Details
Acetone pure EP, NF (pharma grade)
LC-4077.1 1 L

Acetone pure EP, NF (pharma grade)

Sign In for Pricing
View Details
Mouse IL10RB HEK293 Overexpression Lysate
MBS8116906-01 0.3 mg

Mouse IL10RB HEK293 Overexpression Lysate

Sign In for Pricing
View Details