FGF-1, Human
FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.
Product Specifications
Product Name Alternative
FGF-1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-1-protein-human.html
Purity
98.00
Smiles
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular Formula
2246 (Gene_ID) P05230-1 (F16-D155) (Accession)
Molecular Weight
Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6380382-01 0.1 mL
GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (MaxLight 650)
Sign In for Pricing
View Details MBS6380382-02 5x 0.1 mL
GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (MaxLight 650)
Sign In for Pricing
View Details 
C42536 100 µL
Phosphatidylcholine-sterol acyltransferase Polyclonal Conjugated Antibody
Sign In for Pricing
View Details 
MBS4380181-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
DOG-1/TMEM16A (Gastrointestinal Stromal Tumor Marker)
Sign In for Pricing
View Details MBS4380181-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
DOG-1/TMEM16A (Gastrointestinal Stromal Tumor Marker)
Sign In for Pricing
View Details MBS4380181-03 0.1 mg (Without BSA & Azide at 1mg/mL)
DOG-1/TMEM16A (Gastrointestinal Stromal Tumor Marker)
Sign In for Pricing
View Details