Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Human

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

Product Specifications

Product Name Alternative

FGF-1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-human.html

Purity

98.00

Smiles

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

2246 (Gene_ID) P05230-1 (F16-D155) (Accession)

Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)
MBS1159818-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)
MBS1159818-02 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)
MBS1159818-03 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)
MBS1159818-04 0.1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)
MBS1159818-05 0.02 mg (Baculovirus)

Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)
MBS1159818-06 0.02 mg (Mammalian-Cell)

Recombinant Saccharomyces cerevisiae Maltose fermentation regulatory protein MAL33 (MAL33)

Sign In for Pricing
View Details