FGF-1, Human
FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.
Product Specifications
Product Name Alternative
FGF-1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-1-protein-human.html
Purity
98.00
Smiles
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular Formula
2246 (Gene_ID) P05230-1 (F16-D155) (Accession)
Molecular Weight
Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1106932-01 0.02 mg (E-Coli)
Recombinant Human Putative zinc finger protein 705E (ZNF705E)
Sign In for Pricing
View Details MBS1106932-02 0.02 mg (Yeast)
Recombinant Human Putative zinc finger protein 705E (ZNF705E)
Sign In for Pricing
View Details MBS1106932-03 0.1 mg (E-Coli)
Recombinant Human Putative zinc finger protein 705E (ZNF705E)
Sign In for Pricing
View Details MBS1106932-04 0.1 mg (Yeast)
Recombinant Human Putative zinc finger protein 705E (ZNF705E)
Sign In for Pricing
View Details MBS1106932-05 0.02 mg (Baculovirus)
Recombinant Human Putative zinc finger protein 705E (ZNF705E)
Sign In for Pricing
View Details