What is the catalog number for FGF-1, Human?

The catalog number for FGF-1, Human is HY-P7001.

What sizes are available for FGF-1, Human?

FGF-1, Human is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg, 250 µg, 500 µg, 1 mg.

How many pack sizes does FGF-1, Human come in?

FGF-1, Human is available in 7 different pack sizes.

Is FGF-1, Human in stock?

FGF-1, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures FGF-1, Human?

FGF-1, Human is manufactured by QuantiMol.

What is the estimated delivery time for FGF-1, Human?

Estimated delivery time for FGF-1, Human is approximately 15 business day(s), depending on your location.

FGF-1, Human

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

Product Specifications

Product Name Alternative

FGF-1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-human.html

Purity

98.00

Smiles

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

2246 (Gene_ID) P05230-1 (F16-D155) (Accession)

Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-151296-V 200 µL

Olfr998 shRNA (m) Lentiviral Particles

Sign In for Pricing

View Details

FAB5447W 0.1 mL

Mouse Monoclonal Galectin-10 Antibody (561603) [DyLight 650]

Sign In for Pricing

View Details

E45M15739 100 µg

TIPIN Mouse Monoclonal Antibody [Clone:3A1]

Sign In for Pricing

View Details

GTR15134052 1 Vial

Lentiviral human NAF1 shRNA (UAS) - Lentiviral human NAF1 shRNA (UAS, RFP) (100)

Sign In for Pricing

View Details

LS388650 100 µg

DIPK1A (NM_001006605) Human Over-expression Lysate

Sign In for Pricing

View Details

OR23661 1 Each

Ethyl 2-amino-5- (3-oxoprop-1-enyl) -3-furoate

Sign In for Pricing

View Details