Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Human

FGF-1 Protein, Human is a growth factor and signaling protein encoded by the FGF1 gene.

Product Specifications

Product Name Alternative

FGF-1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-human.html

Purity

98.00

Smiles

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

2246 (Gene_ID) P05230-1 (F16-D155) (Accession)

Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1367 (NM_146533) Mouse Tagged ORF Clone Lentiviral Particle
MR213043L4V 200 µL

Olfr1367 (NM_146533) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Versilic stoppers, No. 27D 21 x 27 x 30 mm
1216300 50 PK

Versilic stoppers, No. 27D 21 x 27 x 30 mm

Sign In for Pricing
View Details
Ovine Estrone Sulfate (E1S) ELISA Kit-Competitive
EK1F982 96 Tests

Ovine Estrone Sulfate (E1S) ELISA Kit-Competitive

Sign In for Pricing
View Details
KPNA3 Antibody Blocking peptide
orb1447563 500 µg

KPNA3 Antibody Blocking peptide

Sign In for Pricing
View Details
IFNA22P ORF Vector (Human) (pORF)
ORF021362 1.0 µg DNA

IFNA22P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse 1700016K19Rik shRNA (UAS) - Lentiviral mouse 1700016K19Rik shRNA (UAS) plasmid
GTR15216283 1 Vial

Lentiviral mouse 1700016K19Rik shRNA (UAS) - Lentiviral mouse 1700016K19Rik shRNA (UAS) plasmid

Sign In for Pricing
View Details