Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF2, Human (His)

The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. Animal-Free IGF2 Protein, Human (His) is the recombinant human-derived animal-FreeIGF2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf2-protein-human-his.html

Purity

98.0

Smiles

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

3481 (Gene_ID) P01344-1 (A25-E91) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFR1033 Adenovirus (Mouse)
32531054 1.0 mL

OLFR1033 Adenovirus (Mouse)

Sign In for Pricing
View Details
YIPF5 Human shRNA Plasmid Kit (Locus ID 81555)
TG317554 1 Kit

YIPF5 Human shRNA Plasmid Kit (Locus ID 81555)

Sign In for Pricing
View Details
Monkey Olfactory receptor 52N1 (OR52N1) ELISA Kit
GTR10334780 96 Well

Monkey Olfactory receptor 52N1 (OR52N1) ELISA Kit

Sign In for Pricing
View Details
ZNF207 (FITC)
582098-01 50 µg

ZNF207 (FITC)

Sign In for Pricing
View Details
ZNF207 (FITC)
582098-02 100 µg

ZNF207 (FITC)

Sign In for Pricing
View Details
OLIG2 Recombinant Antibody, Cy5.5 Conjugated
bsm-61115R-Cy5.5 100 µL

OLIG2 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details