Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Human (CHO)

IL-3 Protein, Human (CHO) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

Product Specifications

Product Name Alternative

IL-3 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-human-cho.html

Purity

95.00

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 16-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Monocyte Chemotactic Protein 3 ELISA Kit
MBS735791-01 48 Well

Monkey Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
Monkey Monocyte Chemotactic Protein 3 ELISA Kit
MBS735791-02 96 Well

Monkey Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
Monkey Monocyte Chemotactic Protein 3 ELISA Kit
MBS735791-03 5x 96 Well

Monkey Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
Monkey Monocyte Chemotactic Protein 3 ELISA Kit
MBS735791-04 10x 96 Well

Monkey Monocyte Chemotactic Protein 3 ELISA Kit

Sign In for Pricing
View Details
ZNF297B Overexpression Lysate (Native) - (Dry Ice)
NBP2-07393 0.1 mg

ZNF297B Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
HDAC1 (Histone Deacetylase 1, DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1) (APC)
246968-APC 100 µL

HDAC1 (Histone Deacetylase 1, DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1) (APC)

Sign In for Pricing
View Details