Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Matrix-remodeling-associated protein 7 (MXRA7), partial

Product Specifications

Abbreviation

Recombinant Rat MXRA7 protein, partial

Gene Name

MXRA7

UniProt

F1M1U0

Expression Region

28-146aa

Organism

Rattus norvegicus (Rat)

Target Sequence

RRGAARAPESTTRAGDPGAPAPPEPPEPCALEPPSVGPCQFERLAEPEEEEPEAEGRQDEDSDSEMGPPTEEPEEEAGAAFSFKYSPGQLRGSQYKKMMTKEELEEEQRIELTSDLTSL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRYBB3 Human Gene Knockout Kit (CRISPR)
KN416611 1 Kit

CRYBB3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MYCBP activation kit by CRISPRa
GA108851 1 Kit

Human MYCBP activation kit by CRISPRa

Sign In for Pricing
View Details
HP1 alpha (CBX5) (NM_012117) Human Over-expression Lysate
LC402149 20 µg

HP1 alpha (CBX5) (NM_012117) Human Over-expression Lysate

Sign In for Pricing
View Details
Buccutite™ Rapid APC Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*
1311-AAT 2 Labelings

Buccutite™ Rapid APC Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*

Sign In for Pricing
View Details
Mitochondrial Marker (AE-1), CF594 conjugate, 0.1mg/mL
BNC940905-500 1x 500 µL

Mitochondrial Marker (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin Conjugated Human cIAP2 Recombinant Rabbit Monoclonal Antibody [PSH09-40] - Detector
HA723102B 100 µL

Biotin Conjugated Human cIAP2 Recombinant Rabbit Monoclonal Antibody [PSH09-40] - Detector

Sign In for Pricing
View Details