Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein A-II/APOA2, Human (Truncated, HEK293, His)

Apolipoprotein A-II/APOA2 Protein, Human (Truncated, HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-II (ApoA-II) has been associated with numerous aspects of HDL metabolism, and apoA-II overexpression produces the proatherogenic phenotype[1].

Product Specifications

Product Name Alternative

Apolipoprotein A-II/APOA2 Protein, Human (Truncated, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-a-ii-apoa2-protein-human-hek293-his.html

Purity

95.0

Smiles

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQHHHHHH

Molecular Formula

336 (Gene_ID) P02652 (Q24-Q100) (Accession)

Molecular Weight

10-15 kDa

References & Citations

[1]Smith LE, et al. High yield expression and purification of recombinant human apolipoprotein A-II in Escherichia coli. J Lipid Res. 2012 Aug;53 (8) :1708-15.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL
BNC400824-100 1x 100 µL

CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details