Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8-S100A9 Heterodimer, Human (His)

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A8-S100A9 Heterodimer Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-s100a9-heterodimer-protein-human-c-6his.html

Purity

95.00

Smiles

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE&TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6279&6280 (Gene_ID) P05109 (M1-E93) (S100A8) &P06702 (T2-P114) (S100A9) (Accession)

Molecular Weight

13&15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPC3 antibody
70R-3073 100 µL

ARPC3 antibody

Sign In for Pricing
View Details
AT8A1 Rabbit Polyclonal Antibody
orb3013714 100 µL

AT8A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAV38-2DV8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2447305 3x 1.0 µg

TRAV38-2DV8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium abscessus Malate synthase G (glcB), partial
MBS1047828 Inquire

Recombinant Mycobacterium abscessus Malate synthase G (glcB), partial

Sign In for Pricing
View Details
HSPA4L Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-18082R-BF488 100 µL

HSPA4L Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC) discontinued
043383-FITC 200 µL

TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC) discontinued

Sign In for Pricing
View Details