Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mer, Human (HEK293, His)

MER tyrosine kinase (MERTK) is a transmembrane protein with transmembrane receptor protein tyrosine kinase activity. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling. Mer Protein, Human (HEK293, His) is the recombinant human-derived Mer protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Mer Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mer-protein-human-hek293-his.html

Purity

95.0

Smiles

MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNA

Molecular Formula

10461 (Gene_ID) Q1RMG3 (M1-A323) (Accession)

Molecular Weight

60-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)
MBS1057710-01 0.02 mg (E-Coli)

Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)

Ask
View Details
Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)
MBS1057710-02 0.1 mg (E-Coli)

Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)

Ask
View Details
Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)
MBS1057710-03 0.02 mg (Yeast)

Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)

Ask
View Details
Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)
MBS1057710-04 0.1 mg (Yeast)

Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)

Ask
View Details
Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)
MBS1057710-05 0.02 mg (Baculovirus)

Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)

Ask
View Details
Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)
MBS1057710-06 1 mg (E-Coli)

Recombinant African swine fever virus Protein MGF 110-5L (Mal-010)

Ask
View Details