Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mer, Human (HEK293, His)

MER tyrosine kinase (MERTK) is a transmembrane protein with transmembrane receptor protein tyrosine kinase activity. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling. Mer Protein, Human (HEK293, His) is the recombinant human-derived Mer protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Mer Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mer-protein-human-hek293-his.html

Purity

95.0

Smiles

MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNA

Molecular Formula

10461 (Gene_ID) Q1RMG3 (M1-A323) (Accession)

Molecular Weight

60-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse TNFSF14 Protein, Untagged, E.coli-5ug
QP10890-5ug 5ug

Recombinant Mouse TNFSF14 Protein, Untagged, E.coli-5ug

Ask
View Details
Rat CD163 Antibody (Biotin)
GWB-Q01271 0.1 mg

Rat CD163 Antibody (Biotin)

Ask
View Details
4’-Hydroxy rac-Kavain-d3
TRC-H944522-50MG 50 mg

4’-Hydroxy rac-Kavain-d3

Ask
View Details
RAD23B (UV Excision Repair Protein RAD23 Homolog B, XP-C Repair-complementing Complex 58kD Protein, hHR23B, HR23B, p58) (Biotin)
MBS6143900-01 0.1 mL

RAD23B (UV Excision Repair Protein RAD23 Homolog B, XP-C Repair-complementing Complex 58kD Protein, hHR23B, HR23B, p58) (Biotin)

Ask
View Details
RAD23B (UV Excision Repair Protein RAD23 Homolog B, XP-C Repair-complementing Complex 58kD Protein, hHR23B, HR23B, p58) (Biotin)
MBS6143900-02 5x 0.1 mL

RAD23B (UV Excision Repair Protein RAD23 Homolog B, XP-C Repair-complementing Complex 58kD Protein, hHR23B, HR23B, p58) (Biotin)

Ask
View Details
Gnetol 50mg
A24067-50 50 mg

Gnetol 50mg

Ask
View Details