Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1)

Product Specifications

Product Name Alternative

Secretoglobin RYD5 (Ryd5)

Abbreviation

Recombinant Mouse Scgb1c1 protein

Gene Name

Scgb1c1

UniProt

Q7M742

Expression Region

24-95aa

Organism

Mus musculus (Mouse)

Target Sequence

EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.2 kDa

References & Citations

"A conditional knockout resource for the genome-wide study of mouse gene function." Skarnes W.C., Rosen B., West A.P., Koutsourakis M., Bushell W., Iyer V., Mujica A.O., Thomas M., Harrow J., Cox T., Jackson D., Severin J., Biggs P., Fu J., Nefedov M., de Jong P.J., Stewart A.F., Bradley A. Nature 474:337-342 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPB41L3 Antibody
E51A10567 100 µL

EPB41L3 Antibody

Sign In for Pricing
View Details
MRPS24 Protein Vector (Mouse) (pPM-C-His)
PV202225 500 ng

MRPS24 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Competence-stimulating peptide (comC)
MBS1046879-01 0.05 mg (E-Coli)

Recombinant Competence-stimulating peptide (comC)

Sign In for Pricing
View Details
Recombinant Competence-stimulating peptide (comC)
MBS1046879-02 0.2 mg (E-Coli)

Recombinant Competence-stimulating peptide (comC)

Sign In for Pricing
View Details
Recombinant Competence-stimulating peptide (comC)
MBS1046879-03 0.5 mg (E-Coli)

Recombinant Competence-stimulating peptide (comC)

Sign In for Pricing
View Details
Recombinant Competence-stimulating peptide (comC)
MBS1046879-04 0.05 mg (Yeast)

Recombinant Competence-stimulating peptide (comC)

Sign In for Pricing
View Details