Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Human (His)

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calr-protein-human-his.html

Purity

95.00

Smiles

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Molecular Formula

811 (Gene_ID) P27797 (E18-L417) (Accession)

Molecular Weight

Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os05g0140800 Polyclonal Antibody
MBS7199450 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os05g0140800 Polyclonal Antibody

Sign In for Pricing
View Details
Human Granulin (GRN) ELISA Kit
abx573915 96 Well

Human Granulin (GRN) ELISA Kit

Sign In for Pricing
View Details
ADAM19 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-5850R-BF405 100 µL

ADAM19 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
PTPN22 (Tyrosine-protein Phosphatase Non-receptor Type 22, Hematopoietic Cell Protein-tyrosine Phosphatase 70Z-PEP, Lymphoid Phosphatase, LyP, PEST-domain Phosphatase, PEP, PTPN8) (Biotin)
132065-Biotin 100 µL

PTPN22 (Tyrosine-protein Phosphatase Non-receptor Type 22, Hematopoietic Cell Protein-tyrosine Phosphatase 70Z-PEP, Lymphoid Phosphatase, LyP, PEST-domain Phosphatase, PEP, PTPN8) (Biotin)

Sign In for Pricing
View Details
Human ADRB1 full length protein-synthetic nanodisc
orb1826681-01 10 µg

Human ADRB1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human ADRB1 full length protein-synthetic nanodisc
orb1826681-02 50 µg

Human ADRB1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details