Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-3B/GDF10, Mouse (HEK293, Fc)

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Mouse (HEK293, Fc) has a total length of 110 amino acids (Q367-R476), is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

BMP-3B/GDF10 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-3b-gdf10-protein-mouse-hek293-fc.html

Purity

96.50

Smiles

QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNAVLKVYPNMSVETCACR

Molecular Formula

14560 (Gene_ID) P97737 (Q367-R476) (Accession)

Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Wen J, et al. BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways. J Exp Clin Cancer Res. 2019 Oct 28;38 (1) :428.|[4]Bahamonde ME, et al. BMP3: to be or not to be a BMP. J Bone Joint Surg Am. 2001;83-A Suppl 1 (Pt 1) :S56-62.|[5]Stewart A, et al. BMP-3 promotes mesenchymal stem cell proliferation through the TGF-beta/activin signaling pathway. J Cell Physiol. 2010 Jun;223 (3) :658-66.|[6]Daluiski A, et al. Bone morphogenetic protein-3 is a negative regulator of bone density. Nat Genet. 2001 Jan;27 (1) :84-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) Elisa Kit
EK714788 96 Well

Human Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) Elisa Kit

Sign In for Pricing
View Details
Klhdc8b sgRNA CRISPR Lentivector set (Mouse)
K3187501 3x 1.0 µg

Klhdc8b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
TRNAR8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2519008 1.0 µg DNA

TRNAR8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Monoclonal Bcl-2 Antibody (U.Toronto patent anti-Bax) [DyLight 550]
NBP3-28015R 0.1 mL

Human Monoclonal Bcl-2 Antibody (U.Toronto patent anti-Bax) [DyLight 550]

Sign In for Pricing
View Details
IL-4Ralpha, phosphorylated (Y497) (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)
328813-01 50 µg

IL-4Ralpha, phosphorylated (Y497) (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)

Sign In for Pricing
View Details
IL-4Ralpha, phosphorylated (Y497) (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)
328813-02 100 µg

IL-4Ralpha, phosphorylated (Y497) (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)

Sign In for Pricing
View Details