Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-3B/GDF10, Mouse (HEK293, Fc)

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Mouse (HEK293, Fc) has a total length of 110 amino acids (Q367-R476), is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

BMP-3B/GDF10 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-3b-gdf10-protein-mouse-hek293-fc.html

Purity

96.50

Smiles

QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNAVLKVYPNMSVETCACR

Molecular Formula

14560 (Gene_ID) P97737 (Q367-R476) (Accession)

Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Wen J, et al. BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways. J Exp Clin Cancer Res. 2019 Oct 28;38 (1) :428.|[4]Bahamonde ME, et al. BMP3: to be or not to be a BMP. J Bone Joint Surg Am. 2001;83-A Suppl 1 (Pt 1) :S56-62.|[5]Stewart A, et al. BMP-3 promotes mesenchymal stem cell proliferation through the TGF-beta/activin signaling pathway. J Cell Physiol. 2010 Jun;223 (3) :658-66.|[6]Daluiski A, et al. Bone morphogenetic protein-3 is a negative regulator of bone density. Nat Genet. 2001 Jan;27 (1) :84-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Fluoro-3-methylindole 98+% (HPLC)
234196-01 1 g

5-Fluoro-3-methylindole 98+% (HPLC)

Sign In for Pricing
View Details
5-Fluoro-3-methylindole 98+% (HPLC)
234196-02 5 g

5-Fluoro-3-methylindole 98+% (HPLC)

Sign In for Pricing
View Details
SNORD119 siRNA Oligos set (Human)
44811171 3x 5 nmol

SNORD119 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Calpain 6 Antibody [DyLight 680]
NBP1-76937FR 0.1 mL

Rabbit Polyclonal Calpain 6 Antibody [DyLight 680]

Sign In for Pricing
View Details
Syt8 siRNA Oligos set (Rat)
46009176 3x 5 nmol

Syt8 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Aspergillus fumigatus IgG Control Serum
C132G-1 3 mL

Aspergillus fumigatus IgG Control Serum

Sign In for Pricing
View Details