Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04

Product Specifications

Product Name Alternative

Allergen Api m 6

Abbreviation

Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04 protein

UniProt

P83563

Expression Region

22-92aa

Organism

Apis mellifera (Honeybee)

Target Sequence

FGGFGGFGGLGGRGKCPSNEIFSRCDGRCQRFCPNVVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKCG

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Has porin activity, forming small water-filled channels. Also has a structural role in determining cell shape and ability to grow in low-osmolarity medium.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Β-Glucosidase (β-GC) Activity Assay Kit
E-BC-K822-M-01 48 T (32 samples)

Β-Glucosidase (β-GC) Activity Assay Kit

Sign In for Pricing
View Details
Β-Glucosidase (β-GC) Activity Assay Kit
E-BC-K822-M-02 96 T (80 samples)

Β-Glucosidase (β-GC) Activity Assay Kit

Sign In for Pricing
View Details
Alpha-Endorphin TFA Salt
TRC-E555588-1MG 1 mg

Alpha-Endorphin TFA Salt

Sign In for Pricing
View Details
SNAPC5 Polyclonal Antibody
E-AB-19933-01 20 µL

SNAPC5 Polyclonal Antibody

Sign In for Pricing
View Details
SNAPC5 Polyclonal Antibody
E-AB-19933-02 60 µL

SNAPC5 Polyclonal Antibody

Sign In for Pricing
View Details
SNAPC5 Polyclonal Antibody
E-AB-19933-03 120 µL

SNAPC5 Polyclonal Antibody

Sign In for Pricing
View Details