Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Tumor necrosis factor receptor superfamily member 5 (CD40), partial

Product Specifications

Product Name Alternative

(B-cell surface antigen CD40) (CD40L receptor) (CD antigen CD40)

Abbreviation

Recombinant Pig CD40 protein, partial

Gene Name

CD40

UniProt

Q8SQ34

Expression Region

21-194aa

Organism

Sus scrofa (Pig)

Target Sequence

EPPTSCKENQYPTNSRCCNLCPPGQKLVNHCTEVTETECLPCSSSEFLATWNREKHCHQHKYCDPNLGLQVQREGTSKTDTTCVCSEGHHCTNSACESCTLHSLCFPGLGVKQMATEVSDTICEPCPVGFFSNVSSASEKCQPWTSCESKGLVEQRAGTNKTDVVCGFQSRMRA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.0 kDa

References & Citations

"Characterization of the porcine CD40 molecule." West K.A., Li A.W., Rowden G. Submitted (MAR-2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Prokineticin 2 (PK2)
MBS2002070-01 0.1 mL

Polyclonal Antibody to Prokineticin 2 (PK2)

Sign In for Pricing
View Details
Polyclonal Antibody to Prokineticin 2 (PK2)
MBS2002070-02 0.2 mL

Polyclonal Antibody to Prokineticin 2 (PK2)

Sign In for Pricing
View Details
Polyclonal Antibody to Prokineticin 2 (PK2)
MBS2002070-03 0.5 mL

Polyclonal Antibody to Prokineticin 2 (PK2)

Sign In for Pricing
View Details
Polyclonal Antibody to Prokineticin 2 (PK2)
MBS2002070-04 1 mL

Polyclonal Antibody to Prokineticin 2 (PK2)

Sign In for Pricing
View Details
Polyclonal Antibody to Prokineticin 2 (PK2)
MBS2002070-05 5 mL

Polyclonal Antibody to Prokineticin 2 (PK2)

Sign In for Pricing
View Details
Polyclonal Antibody to Prokineticin 2 (PK2)
MBS2002070-06 5x 5 mL

Polyclonal Antibody to Prokineticin 2 (PK2)

Sign In for Pricing
View Details