Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL3/CINC-2 alpha, Rat (CHO)

CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. CXCL3 Protein, Rat (CHO) is produced in CHO cells.

Product Specifications

Product Name Alternative

CXCL3/CINC-2 alpha Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl3-protein-rat-cho.html

Purity

98.0

Smiles

RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS

Molecular Formula

171551 (Gene_ID) Q10746-1 (R33-S100) (Accession)

Molecular Weight

Approximately 7.6 kDa

References & Citations

[1]Smith DF, et al. GRO family chemokines are specialized for monocyte arrest from flow. Am J Physiol Heart Circ Physiol. 2005 Nov;289 (5) :H1976-84.|[2]Farioli-Vecchioli S, et al. Tis21 knock-out enhances the frequency of medulloblastoma in Patched1 heterozygous mice by inhibiting the Cxcl3-dependent migration of cerebellar neurons.J Neurosci. 2012 Oct 31;32 (44) :15547-64.|[3]Niradiz Reyes, et al. CXCL3 Signaling in the Tumor Microenvironment. Adv Exp Med Biol. 2021;1302:15-24.|[4]Joji Kusuyama, et al. CXCL3 positively regulates adipogenic differentiation. J Lipid Res. 2016 Oct;57 (10) :1806-1820.|[5]Khushboo Gulati, et al. Molecular cloning and biophysical characterization of CXCL3 chemokine. Int J Biol Macromol. 2018 Feb;107 (Pt A) :575-584.|[6]Jinru Weng, et al. CXCL3 overexpression affects the malignant behavior of oral squamous cell carcinoma cells via the MAPK signaling pathway. J Oral Pathol Med. 2021 Oct;50 (9) :902-910.|[7]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Solute Carrier Family 7, Member 9 (SLC7A9) ELISA Kit
EKN49580-01 48 Tests

Human Solute Carrier Family 7, Member 9 (SLC7A9) ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 7, Member 9 (SLC7A9) ELISA Kit
EKN49580-02 96 Tests

Human Solute Carrier Family 7, Member 9 (SLC7A9) ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 7, Member 9 (SLC7A9) ELISA Kit
EKN49580-03 5x 96 Tests

Human Solute Carrier Family 7, Member 9 (SLC7A9) ELISA Kit

Sign In for Pricing
View Details
RPL35AP35 3'UTR GFP Stable Cell Line
TU071453 1.0 mL

RPL35AP35 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ANKRD25 (KANK2) Human siRNA Oligo Duplex (Locus ID 25959)
SR308624 1 Kit

ANKRD25 (KANK2) Human siRNA Oligo Duplex (Locus ID 25959)

Sign In for Pricing
View Details
Kasugamycin Hydrochloride Monohydrate
41110008-2 25 g

Kasugamycin Hydrochloride Monohydrate

Sign In for Pricing
View Details