Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-9/LGALS9, Human (GST)

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (GST) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Galectin-9/LGALS9 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-9-lgals9-protein-human-hek293-gst.html

Purity

97.63

Smiles

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Molecular Formula

3965 (Gene_ID) O00182-2 (M1-T323) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4EBP3 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
TA811912 100 µL

EIF4EBP3 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

Sign In for Pricing
View Details
Human Flt3 ligand/FLT3LG Antibody
E55A06538 100 µg

Human Flt3 ligand/FLT3LG Antibody

Sign In for Pricing
View Details
CD36/SR-B3[Biotin], His & Avi, Human
Z04065-100 100 µg

CD36/SR-B3[Biotin], His & Avi, Human

Sign In for Pricing
View Details
Lentiviral mouse H2-T24 shRNA (UAS) - Lentiviral mouse H2-T24 shRNA (UAS, GFP) plasmid
GTR15262234 1 Vial

Lentiviral mouse H2-T24 shRNA (UAS) - Lentiviral mouse H2-T24 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
COX2 (PTGS2, Prostaglandin G/H Synthase 2, Cyclooxygenase-2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) (PE)
125248-PE 100 µL

COX2 (PTGS2, Prostaglandin G/H Synthase 2, Cyclooxygenase-2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) (PE)

Sign In for Pricing
View Details
Mouse Polyclonal CNTROB Antibody
H00116840-B01P 0.05 mg

Mouse Polyclonal CNTROB Antibody

Sign In for Pricing
View Details