Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-9/LGALS9, Human (GST)

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (GST) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Galectin-9/LGALS9 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-9-lgals9-protein-human-hek293-gst.html

Purity

97.63

Smiles

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Molecular Formula

3965 (Gene_ID) O00182-2 (M1-T323) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HLA DQA1 Antibody
NBP3-13483 100 µL

Rabbit Polyclonal HLA DQA1 Antibody

Sign In for Pricing
View Details
Rat Paox Pre-designed siRNA Set B
SI210041B 1 Each

Rat Paox Pre-designed siRNA Set B

Sign In for Pricing
View Details
Oxalate (Oxalic Acid) Colorimetric Assay Kit
E-BC-K892-M-01 96 Tests

Oxalate (Oxalic Acid) Colorimetric Assay Kit

Sign In for Pricing
View Details
Oxalate (Oxalic Acid) Colorimetric Assay Kit
E-BC-K892-M-02 500 Assays

Oxalate (Oxalic Acid) Colorimetric Assay Kit

Sign In for Pricing
View Details
Selinexor HCl (1393477-72-9 free base)
MF-0151532-01 10mg

Selinexor HCl (1393477-72-9 free base)

Sign In for Pricing
View Details
Selinexor HCl (1393477-72-9 free base)
MF-0151532-02 1g

Selinexor HCl (1393477-72-9 free base)

Sign In for Pricing
View Details