Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-9/LGALS9, Human (GST)

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (GST) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Galectin-9/LGALS9 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-9-lgals9-protein-human-hek293-gst.html

Purity

97.63

Smiles

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Molecular Formula

3965 (Gene_ID) O00182-2 (M1-T323) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Complement Factor H-related 2/CFHR2/CFHL2 Antibody Pair [HRP]
NBP2-79419-5Plates 5 Plates

Mouse Monoclonal Complement Factor H-related 2/CFHR2/CFHL2 Antibody Pair [HRP]

Sign In for Pricing
View Details
ENDOD1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0680607 1.0 µg DNA

ENDOD1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RPL31P34 AAV Vector (Human) (CMV)
41375101 1 µg

RPL31P34 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
ICOSLG Antibody
MBS9409849-01 0.1 mL

ICOSLG Antibody

Sign In for Pricing
View Details
ICOSLG Antibody
MBS9409849-02 5x 0.1 mL

ICOSLG Antibody

Sign In for Pricing
View Details
Involucrin (Inv, Invo, IVL) (HRP)
MBS6124316-01 0.1 mL

Involucrin (Inv, Invo, IVL) (HRP)

Sign In for Pricing
View Details