LRG1, Mouse (HEK293, His)
LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.
Product Specifications
Product Name Alternative
LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html
Purity
96.00
Smiles
LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
Molecular Formula
76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9012223 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FBX15 Polyclonal Antibody
Sign In for Pricing
View Details 
RC212619L4V 200 µL
ATP2B1 (NM_001682) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details GTR15140572 1 Vial
Lentiviral human UBFD1 shRNA (UAS) - Lentiviral human UBFD1 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details MBS6246725-01 0.1 mL
Syntrophin (dystrophin-associated protein A1, 59kD, basic component 1, 59-DAP, 59kD dystrophin-associated protein A1 basic component 1, A1B, Beta-1-syntrophin, BSYN2, DAPA1B, FLJ22442, MGC111389, SNT2, SNT2B1, Syntrophin-2, Tax interaction protein 43, TIP
Sign In for Pricing
View Details