Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heat Shock Protein 27 (HSP27) Antibody (ATTO 680)
abx445674 200 µg

Heat Shock Protein 27 (HSP27) Antibody (ATTO 680)

Sign In for Pricing
View Details
Rabbit Polyclonal Nav1.7 Antibody
NBP2-75581 100 µL

Rabbit Polyclonal Nav1.7 Antibody

Sign In for Pricing
View Details
NOC2L Rabbit pAb
A17918 20 µL

NOC2L Rabbit pAb

Sign In for Pricing
View Details
CSPG4LYP2-set siRNA/shRNA/RNAi Lentivector (Human)
55995091 4x 500 ng

CSPG4LYP2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
LabMol-301
MBS5815352 Inquire

LabMol-301

Sign In for Pricing
View Details
Human DBI Matched Antibody Pair Set [ABP-S-03858]
ABP-S-03858 5 Plates

Human DBI Matched Antibody Pair Set [ABP-S-03858]

Sign In for Pricing
View Details