LRG1, Mouse (HEK293, His)
LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.
Product Specifications
Product Name Alternative
LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html
Purity
96.00
Smiles
LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
Molecular Formula
76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS010551-01 48 Well
Horse Tumor Necrosis Factor Soluble Receptor I ELISA Kit
Sign In for Pricing
View Details MBS010551-02 96 Well
Horse Tumor Necrosis Factor Soluble Receptor I ELISA Kit
Sign In for Pricing
View Details 
MBS010551-03 5x 96 Well
Horse Tumor Necrosis Factor Soluble Receptor I ELISA Kit
Sign In for Pricing
View Details 
MBS010551-04 10x 96 Well
Horse Tumor Necrosis Factor Soluble Receptor I ELISA Kit
Sign In for Pricing
View Details