Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CFL2 Polyclonal Antibody
PHJ97001 100 μg

Anti-CFL2 Polyclonal Antibody

Sign In for Pricing
View Details
1,8-Diazabicyclo[5.4.0]undec-7-ene
TRC-D417090-50G 50 g

1,8-Diazabicyclo[5.4.0]undec-7-ene

Sign In for Pricing
View Details
Adenovirus Universal Nucleic Acid
RT017A 1 Each

Adenovirus Universal Nucleic Acid

Sign In for Pricing
View Details
Human KLRG1 Recombinant Protein
PROTQ96E93-50ug 50 µg

Human KLRG1 Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal Plakophilin 2 Antibody
NBP2-58748 100 µL

Rabbit Polyclonal Plakophilin 2 Antibody

Sign In for Pricing
View Details
RPF2, CT (RPF2, BXDC1, Ribosome production factor 2 homolog, Brix domain-containing protein 1, Ribosome biogenesis protein RPF2 homolog) (Azide free) (HRP) discontinued
041182-HRP 200 µL

RPF2, CT (RPF2, BXDC1, Ribosome production factor 2 homolog, Brix domain-containing protein 1, Ribosome biogenesis protein RPF2 homolog) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details