Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 5-HT7 Alexa Fluor 700 MAb (1015322)
FAB10325N-100UG 100 µg

Human 5-HT7 Alexa Fluor 700 MAb (1015322)

Sign In for Pricing
View Details
Rabbit anti-SPC52 Antibody, Affinity Purified
A305-609A-T 10 µg

Rabbit anti-SPC52 Antibody, Affinity Purified

Sign In for Pricing
View Details
PPIAL4E sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1696507 1.0 µg DNA

PPIAL4E sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
pBluescriptR-ACKR3 Plasmid
PVT21178 2 µg

pBluescriptR-ACKR3 Plasmid

Sign In for Pricing
View Details
SUSD3 Protein Vector (Mouse) (pPM-C-HA)
45908025 500 ng

SUSD3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Chicken Taxilin Beta (TXLNb) ELISA Kit
abx356443-01 96 Tests

Chicken Taxilin Beta (TXLNb) ELISA Kit

Sign In for Pricing
View Details