LRG1, Mouse (HEK293, His)
LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.
Product Specifications
Product Name Alternative
LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html
Purity
96.00
Smiles
LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
Molecular Formula
76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal Bmf Antibody [mFluor Violet 500 SE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP1-76658MFV500 0.1 mL
Rabbit Polyclonal Bmf Antibody [mFluor Violet 500 SE]
Sign In for Pricing
View Details 
041612-PE 200 µL
SF3B1, NT (SF3B1, SAP155, Splicing factor 3B subunit 1, Pre-mRNA-splicing factor SF3b 155kD subunit, Spliceosome-associated protein 155) (PE) discontinued
Sign In for Pricing
View Details 
GTR15352046 1 Vial
Lentiviral human TPCN1 shRNA (UAS) - Lentiviral human TPCN1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details