Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPOR2 (NM_015864) Human Recombinant Protein
TP301468 20 µg

RIPOR2 (NM_015864) Human Recombinant Protein

Sign In for Pricing
View Details
SCN2A Antibody
RQ6208 100 µg

SCN2A Antibody

Sign In for Pricing
View Details
Ancitabine (hydrochloride)
HY-N0093-01 200 mg

Ancitabine (hydrochloride)

Sign In for Pricing
View Details
Ancitabine (hydrochloride)
HY-N0093-02 10 mM - 1 mL

Ancitabine (hydrochloride)

Sign In for Pricing
View Details
Ancitabine (hydrochloride)
HY-N0093-03 1 g

Ancitabine (hydrochloride)

Sign In for Pricing
View Details
Gucy2e 3'UTR GFP Stable Cell Line
TU255581 1.0 mL

Gucy2e 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details