Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASK Human siRNA Oligo Duplex (Locus ID 8573)
SR305637 1 Kit

CASK Human siRNA Oligo Duplex (Locus ID 8573)

Sign In for Pricing
View Details
1-[5- (2-nitrophenyl) thien-2-yl]ethanone
sc-333621A 5 g

1-[5- (2-nitrophenyl) thien-2-yl]ethanone

Sign In for Pricing
View Details
Pax-5 Antibody
MBS9412527-01 0.05 mL

Pax-5 Antibody

Sign In for Pricing
View Details
Pax-5 Antibody
MBS9412527-02 0.1 mL

Pax-5 Antibody

Sign In for Pricing
View Details
Pax-5 Antibody
MBS9412527-03 5x 0.1 mL

Pax-5 Antibody

Sign In for Pricing
View Details
Phosphate regulating gene with homologies to endopeptidases on X (PHEX) polyclonal antibody
ABP-PAB-10954 100 ug

Phosphate regulating gene with homologies to endopeptidases on X (PHEX) polyclonal antibody

Sign In for Pricing
View Details