Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROSC (PLPBP) (NM_007198) Human Tagged Lenti ORF Clone
RC200853L4 10 µg

PROSC (PLPBP) (NM_007198) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
hsa-miR-4451 miRNA Inhibitor
MBS8294065-01 10 nmol

hsa-miR-4451 miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-4451 miRNA Inhibitor
MBS8294065-02 20 nmol

hsa-miR-4451 miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-4451 miRNA Inhibitor
MBS8294065-03 5x 20 nmol

hsa-miR-4451 miRNA Inhibitor

Sign In for Pricing
View Details
SF3B14 / SAP14 (1-125, His-tag) Human Protein
AR09860PU-L 250 µg

SF3B14 / SAP14 (1-125, His-tag) Human Protein

Sign In for Pricing
View Details
Recombinant Borrelia afzelii Probable M18 family aminopeptidase 1 (apeA)
MBS1303996-01 0.02 mg (E-Coli)

Recombinant Borrelia afzelii Probable M18 family aminopeptidase 1 (apeA)

Sign In for Pricing
View Details