Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL43 (39S Ribosomal Protein L43, Mitochondrial, Mitochondrial Ribosomal Protein L43)
486127 100 µL

MRPL43 (39S Ribosomal Protein L43, Mitochondrial, Mitochondrial Ribosomal Protein L43)

Sign In for Pricing
View Details
CSAG4 Recombinant Protein (Human)
RP053200 100 µg

CSAG4 Recombinant Protein (Human)

Sign In for Pricing
View Details
ATP Luminescent Cell Viability Assay Kit
40210ES80 10x 100 mL

ATP Luminescent Cell Viability Assay Kit

Sign In for Pricing
View Details
Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (SPM314) [mFluor Violet 610 SE]
NBP2-34408MFV610 0.1 mL

Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (SPM314) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Human CBLB knockout cell line
ABC-KH2411 1 Vial

Human CBLB knockout cell line

Sign In for Pricing
View Details
Mouse Gpr173 activation kit by CRISPRa
GA208614 1 Kit

Mouse Gpr173 activation kit by CRISPRa

Sign In for Pricing
View Details