Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofascin shRNA (h) Lentiviral Particles
sc-61184-V 200 µL

Neurofascin shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
LY86 sgRNA CRISPR Lentivector set (Human)
K1246201 3x 1.0 µg

LY86 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
VCX2 sgRNA CRISPR Lentivector set (Human)
K2607601 3x 1.0 µg

VCX2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
KIF4CP sgRNA CRISPR Lentivector (Human) (Target 1)
K1146602 1.0 µg DNA

KIF4CP sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Tissue Grinder Potter-Elvehjem, Complete Unit, PTFE Pestle, Sz 23 / 1 Pc.
1219863 1 PC

Tissue Grinder Potter-Elvehjem, Complete Unit, PTFE Pestle, Sz 23 / 1 Pc.

Sign In for Pricing
View Details
Mmu-miR-8117 agomir
HY-R04165A-01 5 nmol

Mmu-miR-8117 agomir

Sign In for Pricing
View Details