Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBB4A Protein Lysate (Mouse) with C-HA Tag
48815034 100 µg

TUBB4A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
RPUSD1 Protein Vector (Human) (pPB-N-His)
PV127323 500 ng

RPUSD1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CETP CytoSection
TS406561P5 25 Slides

CETP CytoSection

Sign In for Pricing
View Details
Methyl 3-chloro-4-methylbenzoate
455214-01 100 mg

Methyl 3-chloro-4-methylbenzoate

Sign In for Pricing
View Details
Methyl 3-chloro-4-methylbenzoate
455214-02 250 mg

Methyl 3-chloro-4-methylbenzoate

Sign In for Pricing
View Details
PRMT7 Blocking Peptide
33R-10612 50 ug

PRMT7 Blocking Peptide

Sign In for Pricing
View Details