Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE Monoclonal Antibody
UB-GEN-12438 100 µL

BACE Monoclonal Antibody

Sign In for Pricing
View Details
ELISA kit for Human Plakophilin-1 (PKP1)
KTE62209-01 48 Tests

ELISA kit for Human Plakophilin-1 (PKP1)

Sign In for Pricing
View Details
ELISA kit for Human Plakophilin-1 (PKP1)
KTE62209-02 96 Tests

ELISA kit for Human Plakophilin-1 (PKP1)

Sign In for Pricing
View Details
ELISA kit for Human Plakophilin-1 (PKP1)
KTE62209-03 5x 96 Well

ELISA kit for Human Plakophilin-1 (PKP1)

Sign In for Pricing
View Details
FCGR1B CRISPRa sgRNA lentivector (set of three targets)(Human)
20384121 3x 1.0µg DNA

FCGR1B CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Canine phosphorylated neurofilament H (pNF-H) ELISA Kit
MBS2611839-01 48 Well

Canine phosphorylated neurofilament H (pNF-H) ELISA Kit

Sign In for Pricing
View Details