Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Mouse (HEK293, His)

LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Molecular Formula

76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)

Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf170 siRNA (Human)
MBS8240501-01 15 nmol

C9orf170 siRNA (Human)

Sign In for Pricing
View Details
C9orf170 siRNA (Human)
MBS8240501-02 30 nmol

C9orf170 siRNA (Human)

Sign In for Pricing
View Details
C9orf170 siRNA (Human)
MBS8240501-03 5x 30 nmol

C9orf170 siRNA (Human)

Sign In for Pricing
View Details
Human BPIFB4 / BPI fold-containing family B member 4 ELISA Kit
MBS2905252-01 48 Well

Human BPIFB4 / BPI fold-containing family B member 4 ELISA Kit

Sign In for Pricing
View Details
Human BPIFB4 / BPI fold-containing family B member 4 ELISA Kit
MBS2905252-02 96 Well

Human BPIFB4 / BPI fold-containing family B member 4 ELISA Kit

Sign In for Pricing
View Details
Human BPIFB4 / BPI fold-containing family B member 4 ELISA Kit
MBS2905252-03 5x 96 Well

Human BPIFB4 / BPI fold-containing family B member 4 ELISA Kit

Sign In for Pricing
View Details