Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (120a.a)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (120a.a) is produced by E.coli (S122-A241), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (120a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human.html

Purity

98.0

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Formula

4803 (Gene_ID) P01138 (S122-A241) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fukutin (FKTN) (NM_001198963) Human Over-expression Lysate
LC434224 20 µg

Fukutin (FKTN) (NM_001198963) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624716 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
CBR1 Antibody
8C14949-AAT 50 µg

CBR1 Antibody

Sign In for Pricing
View Details
Recombinant NAK/TBK1 Antibody
RC-6949-01 50 μL

Recombinant NAK/TBK1 Antibody

Sign In for Pricing
View Details
Recombinant NAK/TBK1 Antibody
RC-6949-02 100 µL

Recombinant NAK/TBK1 Antibody

Sign In for Pricing
View Details
Recombinant NAK/TBK1 Antibody
RC-6949-03 1 mL

Recombinant NAK/TBK1 Antibody

Sign In for Pricing
View Details