Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (120a.a)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (120a.a) is produced by E.coli (S122-A241), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (120a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human.html

Purity

98.0

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Formula

4803 (Gene_ID) P01138 (S122-A241) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICP Std Antimony 10000ug/mL in 6% Tart. Acid tr. HNO3 - 250ML
PSB4B4 250 mL

ICP Std Antimony 10000ug/mL in 6% Tart. Acid tr. HNO3 - 250ML

Sign In for Pricing
View Details
Ranbp2 Mouse shRNA Lentiviral Particle (Locus ID 19386)
TL501860V 500 µL Each

Ranbp2 Mouse shRNA Lentiviral Particle (Locus ID 19386)

Sign In for Pricing
View Details
Adenoregulin
ZFA26068 1 mg

Adenoregulin

Sign In for Pricing
View Details
OR5BC1P Protein Vector (Human) (pPM-C-His)
PV107877 500 ng

OR5BC1P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Enc1 (NM_001003401) Rat Tagged Lenti ORF Clone
RR201837L3 10 µg

Enc1 (NM_001003401) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
STAP1 Protein Lysate (Rat) with C-HA Tag
45677036 100 µg

STAP1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details