Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (120a.a)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (120a.a) is produced by E.coli (S122-A241), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (120a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human.html

Purity

98.0

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Formula

4803 (Gene_ID) P01138 (S122-A241) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNE2 Antibody
CSB-PA004818GA01HU 100 µL

CCNE2 Antibody

Sign In for Pricing
View Details
Lentiviral human C4orf33 shRNA (UAS) - Lentiviral human C4orf33 shRNA (UAS, iRFP) plasmid
GTR15307675 1 Vial

Lentiviral human C4orf33 shRNA (UAS) - Lentiviral human C4orf33 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SCA2/ATXN2 Rabbit Polyclonal Antibody (Cy3)
orb2595436 100 µg

SCA2/ATXN2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
OR6A2 Rabbit Polyclonal Antibody (PE)
orb488775 100 µL

OR6A2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Tyrphostin 25 (RG-50875)
MBS565560-01 5 mg

Tyrphostin 25 (RG-50875)

Sign In for Pricing
View Details
Tyrphostin 25 (RG-50875)
MBS565560-02 5x 5 mg

Tyrphostin 25 (RG-50875)

Sign In for Pricing
View Details