Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX5/Peroxiredoxin-5, Human (HEK293, His)

The PRDX5 protein (or Peroxiredoxin-5) plays a critical role as a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides. This enzyme activity is essential for cells to defend against oxidative stress and detoxify peroxides. PRDX5/Peroxiredoxin-5 Protein, Human (HEK293, His) is the recombinant human-derived PRDX5/Peroxiredoxin-5 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX5/Peroxiredoxin-5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx5-protein-human-hek-293-his.html

Purity

95.0

Smiles

MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Molecular Formula

25824 (Gene_ID) P30044-1 (M53-L214) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Naphthalen-2-yl-pyrrole-2,5-dione
TRC-N377698-5G 5 g

1-Naphthalen-2-yl-pyrrole-2,5-dione

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) CG32751 Polyclonal Antibody
MBS9002099 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) CG32751 Polyclonal Antibody

Sign In for Pricing
View Details
CAT-1 (F-2) HRP
sc-515782 HRP 200 µg/mL

CAT-1 (F-2) HRP

Sign In for Pricing
View Details
safeVIEW-MINI2 Blue Light Transilluminator 15.3 x 15.3 cm
SAFEVIEW-MINI2 1 Unit

safeVIEW-MINI2 Blue Light Transilluminator 15.3 x 15.3 cm

Sign In for Pricing
View Details
Rabbit anti Goat IgM (heavy and light chains)
MBS571864-01 1 mL

Rabbit anti Goat IgM (heavy and light chains)

Sign In for Pricing
View Details
Rabbit anti Goat IgM (heavy and light chains)
MBS571864-02 5x 1 mL

Rabbit anti Goat IgM (heavy and light chains)

Sign In for Pricing
View Details