Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DG1/447 + DOG-1.1]
AM50264PU-T 20 µg

TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DG1/447 + DOG-1.1]

Sign In for Pricing
View Details
TRIM39 Protein Vector (Human) (pPM-C-HA)
47780021 500 ng

TRIM39 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DNM1 Antibody
MBS7119105-01 0.05 mg

DNM1 Antibody

Sign In for Pricing
View Details
DNM1 Antibody
MBS7119105-02 0.1 mg

DNM1 Antibody

Sign In for Pricing
View Details
DNM1 Antibody
MBS7119105-03 5x 0.1 mg

DNM1 Antibody

Sign In for Pricing
View Details
RFPL2 (NM_001159546) Human Tagged ORF Clone
RC228805 10 µg

RFPL2 (NM_001159546) Human Tagged ORF Clone

Sign In for Pricing
View Details