Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZNF107 sgRNA gene knockout kit - Lentiviral human ZNF107 sgRNA gene knockout kit (25)
GTR15379470 1 Vial

Lentiviral human ZNF107 sgRNA gene knockout kit - Lentiviral human ZNF107 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human CCG2-Strep full length protein-synthetic nanodisc
MBS1883717-01 0.01 mg

Human CCG2-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CCG2-Strep full length protein-synthetic nanodisc
MBS1883717-02 0.05 mg

Human CCG2-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CCG2-Strep full length protein-synthetic nanodisc
MBS1883717-03 0.1 mg

Human CCG2-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Gm8720 Protein Vector (Mouse) (pPM-C-His)
PV184937 500 ng

Gm8720 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Glucans biosynthesis protein G (mdoG)
MBS1247629-01 0.02 mg (E-Coli)

Recombinant Klebsiella pneumoniae Glucans biosynthesis protein G (mdoG)

Sign In for Pricing
View Details