Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2BD siRNA (Human)
CRH2051-01 15 nmol

HIST1H2BD siRNA (Human)

Sign In for Pricing
View Details
HIST1H2BD siRNA (Human)
CRH2051-02 30 nmol

HIST1H2BD siRNA (Human)

Sign In for Pricing
View Details
CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (MaxLight 490)
MBS6399839-01 0.1 mL

CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (MaxLight 490)

Sign In for Pricing
View Details
CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (MaxLight 490)
MBS6399839-02 5x 0.1 mL

CD4 (T-cell Surface Glycoprotein CD4, T-cell Surface Antigen T4/Leu-3) (MaxLight 490)

Sign In for Pricing
View Details
Human TAS2R5 Knockout HEK293T cell line
GTR15412188 1 Vial

Human TAS2R5 Knockout HEK293T cell line

Sign In for Pricing
View Details
SPHK1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
45312124 3x 1.0µg DNA

SPHK1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details