Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tfe3 shRNA (UAS) - Lentiviral mouse Tfe3 shRNA (UAS, GFP) plasmid
GTR15164566 1 Vial

Lentiviral mouse Tfe3 shRNA (UAS) - Lentiviral mouse Tfe3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Polyclonal Antibody to Tau (Phospho-Ser404)
35-1109-100 100 µL

Polyclonal Antibody to Tau (Phospho-Ser404)

Sign In for Pricing
View Details
Mouse Anti Rat IgG1 (1 chain specific), Antibody
GWB-5CE04F 1 mL

Mouse Anti Rat IgG1 (1 chain specific), Antibody

Sign In for Pricing
View Details
SMAGP Protein Vector (Mouse) (pPB-N-His)
PV231747 500 ng

SMAGP Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Denatured Ethanol (IPA Denatured) 99.5%
GPS9067-D 500 mL

Denatured Ethanol (IPA Denatured) 99.5%

Sign In for Pricing
View Details
AMZ1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV681351 1.0 µg DNA

AMZ1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details