Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD302/CLEC13A Antibody (071) [Alexa Fluor 488]
NBP2-90687AF488 0.1 mL

Rabbit Monoclonal CD302/CLEC13A Antibody (071) [Alexa Fluor 488]

Sign In for Pricing
View Details
TAPT1 Antibody
E38QA6736 100 µL

TAPT1 Antibody

Sign In for Pricing
View Details
Bid (pS65) Antibody
abx031834-01 80 µL

Bid (pS65) Antibody

Sign In for Pricing
View Details
Bid (pS65) Antibody
abx031834-02 400 µL

Bid (pS65) Antibody

Sign In for Pricing
View Details
Sctr 3'UTR Luciferase Stable Cell Line
TU220011 1.0 mL

Sctr 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse SHROOM3 Protein, His (Fc)-Avi-tagged
SHROOM3-8165M 50 µg

Recombinant Mouse SHROOM3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details