Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-17F ELISpot Set, 10 x 96-well (plates not included)
EA101658 10x 96 Well (Plates Not Included)

Human IL-17F ELISpot Set, 10 x 96-well (plates not included)

Sign In for Pricing
View Details
Fbxl17 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6139704 1.0 µg DNA

Fbxl17 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Salcaprozic Acid
RG-A261708-01 10 mg

Salcaprozic Acid

Sign In for Pricing
View Details
Salcaprozic Acid
RG-A261708-02 25 mg

Salcaprozic Acid

Sign In for Pricing
View Details
Salcaprozic Acid
RG-A261708-03 50 mg

Salcaprozic Acid

Sign In for Pricing
View Details
Salcaprozic Acid
RG-A261708-04 100 mg

Salcaprozic Acid

Sign In for Pricing
View Details