Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ABHD15 Antibody
NBP2-82547-0.1mL 0.1 mL

Rabbit Polyclonal ABHD15 Antibody

Ask
View Details
Toll-like receptor 1 antibody
MBS832906-01 0.025 mg

Toll-like receptor 1 antibody

Ask
View Details
Toll-like receptor 1 antibody
MBS832906-02 0.1 mg

Toll-like receptor 1 antibody

Ask
View Details
Toll-like receptor 1 antibody
MBS832906-03 5x 0.1 mg

Toll-like receptor 1 antibody

Ask
View Details
PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antige
MBS6138407-01 0.1 mL

PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antige

Ask
View Details
PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antige
MBS6138407-02 5x 0.1 mL

PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antige

Ask
View Details