Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD54 (ICAM-1, Intercellular Adhesion Molecule 1, Human Rhinovirus Receptor, Precursor, BB2, Major Group Rhinovirus Receptor, P3.58) (MaxLight 550)
C2409-14B-ML550 100 µL

CD54 (ICAM-1, Intercellular Adhesion Molecule 1, Human Rhinovirus Receptor, Precursor, BB2, Major Group Rhinovirus Receptor, P3.58) (MaxLight 550)

Ask
View Details
Rabbit anti-human Transforming growth factor beta-2 polyclonal Antibody, Biotin conjugated
MBS1491175-01 0.05 mg

Rabbit anti-human Transforming growth factor beta-2 polyclonal Antibody, Biotin conjugated

Ask
View Details
Rabbit anti-human Transforming growth factor beta-2 polyclonal Antibody, Biotin conjugated
MBS1491175-02 0.1 mg

Rabbit anti-human Transforming growth factor beta-2 polyclonal Antibody, Biotin conjugated

Ask
View Details
Rabbit anti-human Transforming growth factor beta-2 polyclonal Antibody, Biotin conjugated
MBS1491175-03 5x 0.1 mg

Rabbit anti-human Transforming growth factor beta-2 polyclonal Antibody, Biotin conjugated

Ask
View Details
Fabp7 (NM_021272) Mouse Tagged ORF Clone Lentiviral Particle
MR200772L4V 200 µL

Fabp7 (NM_021272) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
160 kDa Neurofilament antibody
10R-2281 1 mL

160 kDa Neurofilament antibody

Ask
View Details