Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Aurora A (Serine/Threonine-protein Kinase 6, Aurora Kinase A, Serine/Threonine-protein Kinase Aurora-A, Serine/Threonine-protein Kinase 15, Aurora/IPL1-related Kinase 1, Aurora-related Kinase 1, ARK-1, hARK1, Breast Tumor-amplified Kinase, AURKA, ARK1, AU
MBS6156667-01 0.1 mL

Aurora A (Serine/Threonine-protein Kinase 6, Aurora Kinase A, Serine/Threonine-protein Kinase Aurora-A, Serine/Threonine-protein Kinase 15, Aurora/IPL1-related Kinase 1, Aurora-related Kinase 1, ARK-1, hARK1, Breast Tumor-amplified Kinase, AURKA, ARK1, AU

Ask
View Details
Aurora A (Serine/Threonine-protein Kinase 6, Aurora Kinase A, Serine/Threonine-protein Kinase Aurora-A, Serine/Threonine-protein Kinase 15, Aurora/IPL1-related Kinase 1, Aurora-related Kinase 1, ARK-1, hARK1, Breast Tumor-amplified Kinase, AURKA, ARK1, AU
MBS6156667-02 5x 0.1 mL

Aurora A (Serine/Threonine-protein Kinase 6, Aurora Kinase A, Serine/Threonine-protein Kinase Aurora-A, Serine/Threonine-protein Kinase 15, Aurora/IPL1-related Kinase 1, Aurora-related Kinase 1, ARK-1, hARK1, Breast Tumor-amplified Kinase, AURKA, ARK1, AU

Ask
View Details
ERCC8 Mouse Monoclonal Antibody [Clone ID: OTI2G1]
CF808524 100 µg

ERCC8 Mouse Monoclonal Antibody [Clone ID: OTI2G1]

Ask
View Details
Rabbit Polyclonal SLC4A5 Antibody
NBP2-93493-0.02mL 0.02 mL

Rabbit Polyclonal SLC4A5 Antibody

Ask
View Details
Monkey Olfactory receptor 6C68 (OR6C68) ELISA Kit
MBS7230546-01 48 Well

Monkey Olfactory receptor 6C68 (OR6C68) ELISA Kit

Ask
View Details
Monkey Olfactory receptor 6C68 (OR6C68) ELISA Kit
MBS7230546-02 96 Well

Monkey Olfactory receptor 6C68 (OR6C68) ELISA Kit

Ask
View Details