Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, C-hFc)

The 4-1BB/TNFRSF9 protein (TNFSF9/4-1BBL receptor) sends critical signals that enhance the survival, cytotoxicity, and mitochondrial activity of CD8 (+) T cells, thereby promoting immunity against viruses and tumors.Mainly a homodimer, it can exist in a monomeric state.4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, C-hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-164a-a-hek293-c-hfc.html

Purity

95.00

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

Approximately 58.72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3Orf34 (CEP19) Human Recombinant Protein
TP725730 50 µg

C3Orf34 (CEP19) Human Recombinant Protein

Sign In for Pricing
View Details
AXUD1 shRNA (h) Lentiviral Particles
sc-60237-V 200 µL

AXUD1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Mouse Monoclonal ErbB4/Her4 Antibody (182818) [Janelia Fluor 669]
FAB11311JF669 0.1 mL

Mouse Monoclonal ErbB4/Her4 Antibody (182818) [Janelia Fluor 669]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) purH Polyclonal Antibody
MBS7177109 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) purH Polyclonal Antibody

Sign In for Pricing
View Details
FA83A rabbit pAb
UB-GEN-9361 100 µL

FA83A rabbit pAb

Sign In for Pricing
View Details
AEE788 (Standard)
HY-10045R 1 Each

AEE788 (Standard)

Sign In for Pricing
View Details