Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

Product Specifications

Product Name Alternative

(Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)

Abbreviation

Recombinant Human TACSTD2 protein, partial (Active)

Gene Name

TACSTD2

UniProt

P09758

Expression Region

31-274aa

Organism

Homo sapiens (Human)

Target Sequence

QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

May function as a growth factor receptor.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody (CSB-RA023072MA1HU), the EC50 is 0.9108-1.640 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.3 kDa

References & Citations

"A missense mutation in the M1S1 gene found in a turkish patient with gelatinous droplike corneal dystrophy." Yildirim N., Muslumanoglu H., Isiksoy S., Sahin A., Baycu C., Artan S. Cornea 26:1017-1020 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UE-01 25 µg

APC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
APC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UE-02 100 µg

APC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
UBE2Q2 (Center) Rabbit Polyclonal Antibody
AP54442PU-N 400 µL

UBE2Q2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Danio rerio Beta-actin/ACTB protein (His Tag)
PDEO100020-01 20 µg

Recombinant Danio rerio Beta-actin/ACTB protein (His Tag)

Sign In for Pricing
View Details
Recombinant Danio rerio Beta-actin/ACTB protein (His Tag)
PDEO100020-02 100 µg

Recombinant Danio rerio Beta-actin/ACTB protein (His Tag)

Sign In for Pricing
View Details
Recombinant Danio rerio Beta-actin/ACTB protein (His Tag)
PDEO100020-03 500 µg

Recombinant Danio rerio Beta-actin/ACTB protein (His Tag)

Sign In for Pricing
View Details