Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-related protein A1 (BCL2A1)

Product Specifications

Product Name Alternative

(Bcl-2-like protein 5) (Bcl2-L-5) (Hemopoietic-specific early response protein) (Protein BFL-1) (Protein GRS)

Abbreviation

Recombinant Human BCL2A1 protein

Gene Name

BCL2A1

UniProt

Q16548

Expression Region

1-175aa

Organism

Homo sapiens (Human)

Target Sequence

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection . Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

61.3 kDa

References & Citations

"UBQLN4 is an ATM substrate that stabilizes the anti-apoptotic proteins BCL2A1 and BCL2L10 in mesothelioma." Liu F., Pan R., Ding H., Gu L., Yang Y., Li C., Xu Y., Hu R., Chen H., Zhang X., Nie Y. Mol. Oncol. 15:3738-3752 (2021)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)
MBS2102145-01 5x 96 Tests

Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)

Ask
View Details
Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)
MBS2102145-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)

Ask
View Details
Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)
MBS2102145-03 10x 96 Tests

Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)

Ask
View Details
Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)
MBS2102145-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Fibroblast Growth Factor 22 (FGF22) Antibody Pair Kit (with Standard)

Ask
View Details
PDE4D3, Control Peptide (cAMP-specific 3',5'-cyclic Phosphodiesterase 4D, DPDE3, PDE43) discontinued
148311 100 µg

PDE4D3, Control Peptide (cAMP-specific 3',5'-cyclic Phosphodiesterase 4D, DPDE3, PDE43) discontinued

Ask
View Details
LYN B, Active, Recombinant, Human (Lyn B, V-yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog, Lyn, Lck/Yes-related Novel Protein Tyrosine Kinase) discontinued
220015 5 µg

LYN B, Active, Recombinant, Human (Lyn B, V-yes-1 Yamaguchi Sarcoma Viral Related Oncogene Homolog, Lyn, Lck/Yes-related Novel Protein Tyrosine Kinase) discontinued

Ask
View Details